KEGG   Leclercia adecarboxylata: APT61_00665Help
Entry
APT61_00665       CDS       T04232                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
lax  Leclercia adecarboxylata
Pathway
lax00620  Pyruvate metabolism
lax00680  Methane metabolism
lax01100  Metabolic pathways
lax01120  Microbial metabolism in diverse environments
lax01200  Carbon metabolism
Module
lax_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:lax00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    APT61_00665
  Energy metabolism
   00680 Methane metabolism
    APT61_00665
Enzymes [BR:lax01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     APT61_00665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ALZ94603
LinkDB All DBs
Position
complement(147995..150646)
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGDTIKDALGENILDRVETIRKLSKSSRAGNEANRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPNGEGASNPEVIARTLRKLKDQPDLNEA
TIKKAVESLSLELVLTAHPTEITRRTLIHKMGEVNNCLKQLDNKEIADYERNQLMRRLRQ
LIAQSWHTDEIRKHRPSPVDEAKWGFAVVENSLWEGVPNYLRELNEQLEENLGYRLPVDF
VPVRFTSWMGGDRDGNPNVTAEITRHVLLLSRWKATDLFLKDIQILISELSMVEATPELL
ELVGEAGATEPYRFLLKNLRSQLLATQAWLEARLKGQRLPKPAGLLSQNEQLWEPLYACY
QSLQACGMGIIANGELLDTLRRVKCFGVPLVRIDVRQESTRHTEALGELTRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRSWAPSEETREVLDTCKAIVDAPKGSVAAYVISMAKTP
SDVLAVHLLLKEAGITFALPVAPLFETLDDLNNANDVMTQLLNIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLSLYTSAILEANLLPPPEPKDAWRHIMDEL
SDISCDMYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQKVVEDGKQNELESMCRDWPFFSTRLGMLEMVFSKADLWLAE
YYDQRLVKPELWALGSELRELLQDDIKVVLDIANDSHLMADLPWIAESIQLRNIYTDPLN
VLQAELLYRSRKAEEEGLEPDPRVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcgttgcgtagtaatgtcagtatgctcggcaaggtgctggga
gataccatcaaggatgcgttgggcgagaacattctcgatcgcgttgaaacaatccgtaag
ctgtctaaatcttcccgtgccggtaacgaagccaaccgtcaggagctgctcaccacgttg
cagaacctctctaacgacgagctgctgcccgttgcccgtgccttcagccagtttcttaac
ctggcgaataccgccgaacagtaccatagcatttcgccgaatggcgaaggggccagcaac
ccggaagtgattgcccgcacgctcagaaaactcaaggaccaacccgatctcaacgaagcg
accatcaaaaaggccgttgagtctctgtcactggagctggtgctgaccgcccacccaact
gagattacccgccgcaccctgatccataaaatgggtgaagtgaacaactgcctgaagcaa
cttgataataaagagattgctgactacgaacgtaaccagctgatgcgccgtctgcgccag
ctgattgctcagtcctggcataccgatgaaatccgtaagcaccgcccaagcccggttgac
gaagccaaatggggctttgcagtggtggaaaacagcctgtgggaaggggtgcctaactac
ctgcgcgagctgaatgaacagctggaagagaacctcggctatcgcctgccggtggatttt
gttccggtgcgcttcacctcctggatgggcggcgaccgcgacggcaacccgaacgttacc
gccgagatcactcgccacgtcctgctgctcagccgctggaaagccaccgatctgttcctg
aaagacattcagattttgatctcagagctgtcgatggtcgaagccacgccagaactgctt
gagctggtaggtgaagccggtgcaaccgaaccttaccgcttcctgctcaaaaacctgcgc
agccagctgctggccactcaggcctggctggaagcgcgccttaaaggccagcgtctgccg
aaacccgccggtctgctcagccagaacgagcagctgtgggagccgctatacgcctgttat
cagtcactgcaagcctgcgggatgggcatcatcgcgaacggcgagctgctcgataccctg
cgccgcgtgaaatgtttcggcgtgccgctggtgcgtatcgacgtgcgtcaggaaagcacc
cgtcacaccgaggcgctgggcgagctgacccgctatctcggcattggcgactacgaaagc
tggtcagaagccgacaaacaggccttcctgatccgcgaactgaattccaaacgtcctctg
ctgccgcggagctgggcaccaagtgaagagacccgtgaagtgctcgacacctgcaaagcg
atcgtcgatgcgccgaaaggatcggtggcggcctatgtgatctccatggcgaaaaccccg
tccgacgtgctggcggttcacctgctgctgaaagaagcgggcattacctttgctctgccg
gtcgcgccgctgtttgaaacgctcgatgacctgaataacgccaacgacgtgatgacccag
ctgctgaacatcgactggtatcgcggctttatccagggcaagcagatggtcatgatcggc
tattccgactccgcaaaagatgcgggcgtgatggccgcctcctgggcgcagtatcaggca
caagatgcgctgatcaaaacctgcgaaaaagccgggattgaactgaccctgttccacggt
cgcggcggctcgattggccgtggcggtgcccctgctcatgcggccctgctctctcaaccg
ccgggcagcctgaaaggcggcctgcgtgtgaccgaacaaggcgaaatgatccgcttcaag
tacggtctgccggaagtcaccatcagcagcctgtcgctctacaccagtgcgatcctcgaa
gcgaacctgctgccgccgccggagcctaaagatgcctggcgtcatatcatggacgaactg
tccgacatctcgtgcgacatgtaccgcggctatgtgcgcgaaaacaaagacttcgtgcct
tacttccgctcggcaacgccggagcaggagctgggcaaactgccgctgggttcacgtccg
gcaaaacgtcgcccgactggcggggttgagtccctgcgtgctatcccgtggatcttcgcc
tggacgcagaaccgactgatgctcccggcctggctgggtgccggtgccgctctgcaaaaa
gtggtggaagacgggaagcagaacgaactggaatccatgtgccgcgactggccgttcttc
tccacgcgcctcggcatgctggaaatggtgttctcgaaagccgacctgtggctggcggaa
tactacgatcagcgtctggtgaaaccggagctgtgggcgctgggcagcgagctgcgcgag
ctgctgcaagacgacatcaaagtggtgctggatatcgccaacgactcccatctgatggcc
gatctgccatggattgccgagtccatccagctgcgtaacatctacaccgacccgctgaac
gtgctgcaggcagagctgctgtaccgttcgcgtaaagcggaagaagaaggtcttgagccg
gatccacgtgtggaacaagcgctgatggtcaccatcgcaggtgttgcggcgggcatgcgt
aacacgggttaa

DBGET integrated database retrieval system