KEGG   Leclercia adecarboxylata: APT61_07320Help
Entry
APT61_07320       CDS       T04232                                 

Definition
(GenBank) 6-phospho-beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
lax  Leclercia adecarboxylata
Pathway
lax00010  Glycolysis / Gluconeogenesis
lax00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:lax00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    APT61_07320
   00500 Starch and sucrose metabolism
    APT61_07320
Enzymes [BR:lax01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     APT61_07320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: ALZ95826
UniProt: A0A356XLI1
LinkDB All DBs
Position
1577541..1578935
Genome map
AA seq 464 aa AA seqDB search
MKTFPNDFLWGGAVAANQVEGAYLEDGKGLSTSDVQPQGVFGPVVERVAGDSGIKDVAID
FYHRYPEDIKLFAEMGFNCLRVSIAWTRIFPNGDEQQPNEAGLAFYDKLFDELAAHNITP
LVTLSHYEMPWGLVKQYGGWGNRQVIGFFEHYVRTVFTRYQHKVKLWLTFNEINMSLHAP
MTGVGLPETSSKAEVYQAIHHQLVASALAVKACHEIIPDAKIGNMLLGGLVYPLTCKPDD
VLEALQENRAWQFFGDVQCRGAYPGYMLRFFRDNGITLEITEADREALKSTIDFISFSYY
MTGCVTTDDELNQQARGNILSMVPNPHLASSEWGWQIDPVGLRTLLNVLWDRYQKPLFIV
ENGLGAKDKPDADGMVQDDYRISYLNDHLVQVREAIEDGVEVMGYTSWGPIDLVSASRAE
LSKRYGFIYVDRDDSGAGTLARSRKKSFYWYQEVIATHGASLKG
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactttcccgaatgattttttatggggcggcgcggttgccgcgaatcaggtcgaa
ggggcttacctggaggatggcaaagggttgtccacctctgacgtccagccgcagggggtg
tttggcccggtcgtggagcgggtggctggcgacagcggcattaaagacgtggcgatcgat
ttctatcaccgctacccggaagatatcaaactgttcgccgaaatgggcttcaactgcctg
cgcgtctccattgcctggacacgtatcttcccgaacggcgatgagcagcaaccgaacgag
gccggactggccttttacgacaagctgtttgacgagctggcggcgcataacatcaccccg
ctggtgacgctctcacattacgagatgccgtgggggctggtgaaacagtacggcggctgg
ggcaaccgtcaggtgatcggtttcttcgaacactatgtccgcaccgtcttcacccgctat
cagcataaggtcaagctgtggctcacctttaacgagatcaacatgtccttgcacgcgccg
atgaccggcgtcggtctgccggagaccagcagcaaggcggaggtttatcaggcgatccac
catcagctggtggcgagcgcgctggcggtaaaagcctgccacgagattatcccggacgcg
aaaatcggcaacatgctgctgggcggcctggtctatccgctgacctgcaagccagacgac
gtgctggaagccctgcaggagaaccgcgcctggcagttcttcggggatgtgcagtgccgc
ggggcgtacccgggctatatgctgcgcttcttccgcgataacggcattacccttgagatc
accgaggccgatcgcgaggcgctgaaatcgactatcgactttatctccttcagctattac
atgaccggctgtgtcaccaccgacgacgagctgaatcagcaggcgcgcggcaacatcctg
agcatggtgccgaatccgcatctggccagctcggagtggggctggcagatcgacccggtt
ggcctgcgcaccttactgaacgtgctctgggatcggtatcagaagccgctgttcattgtt
gagaacggtctgggcgcgaaggacaagccggacgcggacggcatggtgcaggacgattac
cgtatcagctacctcaacgaccatctggtgcaggtgcgagaggcgattgaggacggcgtg
gaggtgatgggctacaccagctggggaccgatcgatctggtgagcgcctccagagcggag
ctttccaaacgctacggttttatctacgtcgatcgtgacgacagcggggcaggcacgctg
gcgcgcagccgcaagaagagtttttactggtatcaggaagtgattgcgacccacggcgct
tcgctgaaaggctaa

DBGET integrated database retrieval system