KEGG   Leclercia adecarboxylata: APT61_12175
Entry
APT61_12175       CDS       T04232                                 

Definition
(GenBank) sensor protein RstB
  KO
K07639  two-component system, OmpR family, sensor histidine kinase RstB [EC:2.7.13.3]
Organism
lax  Leclercia adecarboxylata
Pathway
lax02020  Two-component system
Brite
KEGG Orthology (KO) [BR:lax00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    APT61_12175
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lax01001]
    APT61_12175
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:lax02022]
    APT61_12175
Enzymes [BR:lax01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     APT61_12175
Protein kinases [BR:lax01001]
 Histidine kinases
  OmpR family
   APT61_12175
Two-component system [BR:lax02022]
 OmpR family
  RstB-RstA
   APT61_12175
SSDB
Motif
Pfam: HATPase_c HAMP HisKA HATPase_c_2 HATPase_c_3 HATPase_c_5
Other DBs
NCBI-ProteinID: ALZ96731
LinkDB
Position
2622161..2623459
AA seq 432 aa
MKKLFVQFYLLLFVCFLVMAMLVGLVYKFTAERAGRQSLDDLMKSSLYLMRSELREIPPH
DWARTIKELDLNLSFKLRIEPLKKYDLDAPTMQRLRGGDIVALDDQYTFIQRIPRSHYVL
AVGPVPYLYFLHQMRLLDLVLLAFIAISLAFPVFIWMRPHWQDMLRLEAAAQRFGDGHLT
ERIHFDSASSFERLGVAFNQMADNINALIASKKQLIDGIAHELRTPLVRLRYRLEMSENL
TAAESQALNRDIGQLEALIEELLTYARLDRPQNELKLTTPDLPAWLRSYVEDVQSVNPQR
TLLIDSMGGDYGALDMRLMERVLDNLVNNALRYSDNTLRISLHLSGSRATLSVEDDGPGI
APEARQRVFEPFVRLDPSRDRATGGCGLGLAIVHSIAQALGGDVSCDASDLGGARFCFNW
PVWHHIALPIPD
NT seq 1299 nt   +upstreamnt  +downstreamnt
atgaaaaagctgttcgtgcagttttacctcctgctgtttgtctgcttcctggtgatggcc
atgctggtcgggctggtctacaaattcaccgccgagcgcgcgggcaggcaatcgctggat
gacctgatgaaaagctcgctctatctgatgcgtagcgaactgcgtgagatccctcctcac
gactgggcgcgcaccattaaggagctggatctgaatttgtccttcaaactgcgcatcgaa
ccgttgaaaaagtacgacctggatgccccgaccatgcagcgccttcgtgggggtgacatc
gtggcgctggacgatcaatacacctttatccagcgtatcccgcgcagccactatgtgctg
gcggttggcccggtgccctacctctatttcctgcaccagatgcgcctgctggatctcgtc
ctgctggcctttatcgccatttcgctggccttcccggtctttatctggatgcgtccccac
tggcaggacatgctccgccttgaggccgctgcccagcgctttggcgacggccacctgacc
gaacggatccatttcgacagcgcctccagctttgagcgtctgggcgtggcctttaaccag
atggccgacaacatcaatgcgctgatcgccagcaaaaagcagctgatcgacggtatcgcc
cacgagctgcgtaccccgctggtgcggttgcgttaccggctggagatgagtgagaacctg
accgcggcggaatcacaggcgctgaatcgcgatatcggccaacttgaggcgctgattgag
gagctgctgacctatgcccggctcgatcgtccgcagaacgaacttaaactcaccaccccg
gatctgcccgcctggttgcgcagctatgttgaagacgtgcagagcgttaacccccagcgc
acgctgctgattgacagcatgggcggcgattatggcgcgctggatatgcgtttgatggag
cgggtgctggataatctggttaataacgccctgcgctacagcgataacaccctgcgaatt
tcactgcacctgagcgggagccgcgccacgctgtcggtggaggatgacggcccgggcatt
gcaccagaggcgcgtcagcgggtgtttgaaccctttgtccgactcgacccgagccgcgac
cgcgccaccggcggctgcggcctggggctggctatcgtccactcgatcgctcaggcgctg
ggcggcgatgtcagctgcgacgcgagcgatctcggcggcgccaggttctgcttcaactgg
cccgtctggcatcatatcgcccttcccatccctgactga

DBGET integrated database retrieval system