KEGG   Leclercia adecarboxylata: APT61_16510Help
Entry
APT61_16510       CDS       T04232                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lax  Leclercia adecarboxylata
Brite
KEGG Orthology (KO) [BR:lax00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    APT61_16510
Enzymes [BR:lax01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     APT61_16510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored HI0933_like FAD_binding_2 NAD_binding_8 Thi4 FAD_binding_3 K_oxygenase Glutaredoxin AlaDh_PNT_C FMO-like DAO
Motif
Other DBs
NCBI-ProteinID: ALZ97520
LinkDB All DBs
Position
complement(3530699..3532261)
Genome map
AA seq 520 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIKELLAEIAELSEKVTFKEDNSLPV
RKPSFLITNPGSTQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDIEGDFE
FETYYSLSCHNCPDVVQALNLMAVLNPRIKHTAIDGGVFQNEITDRNVMGVPAVFVNGRE
FGQGRMTLTEIVAKVDTGAEKRAAEELNKRDAYDVLIVGSGPAGAAAAVYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVNDYEVDVIDSQSASKLVPAAQEG
GFHEIETASGAVLKARSIIIATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPEMKADQVLQDKVRSLKNVDIILNAQTTEVKGD
GSKVTGLEYRDRVSGDVHSVALAGIFVQIGLLPNTTWLEGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDHLIRTKA
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacacaaatatgaaaacccagctcaaagcctaccttgagaagctgaccaaacct
gttgagctgattgccacgctggacgacagcgctaaatcggcagaaatcaaggaactgctg
gcagaaattgccgaactgtctgagaaagtgaccttcaaggaagataacagcctgccggtg
cgcaagccgtccttcctgatcaccaacccaggctctactcagggtccgcgctttgccggt
tccccgttgggacacgaatttacttcactggtgctggcgctgctgtggaccggtggtcat
ccgtcgaaagaggcgcaggcgctgctggagcagatccgcgatatcgagggtgattttgaa
tttgaaacttactactcgctctcctgccacaactgcccggacgtggtacaggccctgaac
ctgatggcggtgctgaacccacgcatcaaacataccgcgattgacggcggcgtgttccag
aacgaaatcaccgatcgcaacgtgatgggcgttccggccgtgtttgtgaacggcagagag
tttggtcagggtcgtatgacacttacagagatcgttgccaaagtggacaccggcgctgaa
aaacgcgctgctgaagagctgaacaagcgtgatgcctatgatgtgctgatcgttggctcc
ggcccggcgggtgcggcggcggcagtttactctgcccgtaaaggcattcgtaccggtctg
atgggcgaacgtttcggcggccaggtactggatacggtcgatatcgaaaactatatctct
gtgccaaaaaccgaaggtcaaaaactggctggcgcgctgaaagcgcacgtcaatgactat
gaagtggatgtgatcgacagccagagcgccagcaagctggtgcctgcggcgcaggaaggc
ggcttccatgagattgaaaccgcctctggcgcggtgctgaaagcgcgcagcatcatcatt
gctaccggtgccaagtggcgcaacatgaacgtgccaggtgaagatcagtatcgcaccaaa
ggtgtgacctactgcccgcactgcgacggcccgctgtttaaaggcaagcgcgttgcggtg
attggcggcggtaactccggtgtggaagcggcaattgacctggcgggcattgttgaacac
gttacgttgctggaattcgcgccagagatgaaggccgaccaggttctgcaggataaagtg
cgcagcctgaaaaacgtcgatatcatcctgaacgcgcagaccaccgaagtgaaaggcgac
ggcagcaaagtgaccggtcttgagtaccgtgaccgcgtgagtggcgatgtacacagcgtc
gcgttggccgggatcttcgttcagattggtctgctgcctaacaccacctggctggaaggc
gcgattgagcgtaaccgcatgggcgagatcatcatcgatgccaaatgtgaaaccagcgtg
aagggcgtgtttgcggcgggcgactgcaccaccgtaccgtacaaacagattatcatcgcg
accggcgaaggggcgaaagcctccctgagcgccttcgatcatctgattcgcaccaaagca
taa

DBGET integrated database retrieval system