KEGG   Leclercia adecarboxylata: APT61_17590Help
Entry
APT61_17590       CDS       T04232                                 

Definition
(GenBank) multidrug transporter
  KO
K08161  MFS transporter, DHA1 family, multidrug resistance protein
Organism
lax  Leclercia adecarboxylata
Brite
KEGG Orthology (KO) [BR:lax00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lax02000]
    APT61_17590
Transporters [BR:lax02000]
 Major Facilitator Superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-1 (12 spanner) (DHA1) family [TC:2.A.1.2]
    APT61_17590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_1_like MFS_3 MFS_4 LacY_symp DUF3180
Motif
Other DBs
NCBI-ProteinID: ALZ97726
UniProt: A0A358HJ40
LinkDB All DBs
Position
complement(3777936..3779159)
Genome map
AA seq 407 aa AA seqDB search
MESWKVNLISVWFGCFFTGLAISQILPFLPLYVSQLGVSSHEALSMWSGLTFSVTFLVSA
IVSPMWGSLADRKGRKLMLLRASLGMAIAILLQAFATNVWQLFLLRALMGLTSGYIPNAM
ALVASQVPRERSGWAISTLSTAQISGVIGGPLMGGFLADHVGLRAVFLITAVLLVISFLV
TLFLIKEGARPSVSKAERLSGKAVFASLPYPWLMISLFVTTMVIQLCNGSVGPILALFIQ
SMAPESSNIAFLSGMIAAVPGISALMSAPRLGKLGDRIGTGRILMATLVVAVVLFFAMSF
VTTPFQLGVLRFLLGFADGAMLPAVQTLLIKYSSDRVTGRIFGYNQSFMYLGNVAGPLMG
AAVSAMAGFRWVFFATAVVILLNIIQLAWAMRRRRQQEDRTRQIKRL
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggaatcctggaaagttaacctcatttcggtctggtttggttgttttttcaccggcctc
gccatcagccagattttacccttcttgccgctgtatgtgtcccagcttggcgtctcctcc
catgaggcgctgtcaatgtggtcggggctgaccttcagcgtcacttttctggtttcagct
atcgtctcaccgatgtggggcagccttgccgatcgtaaagggcgcaagctgatgctgctg
cgcgcctcgctggggatggcgattgcgatcctgctccaggcctttgccaccaacgtctgg
caattgttcctgctgcgggcgctgatggggctgacgtccggctatattccgaacgccatg
gcgctggtggcatcgcaggtgccccgtgagcgcagtggctgggccatcagcacgctctca
acggcacagatcagcggcgtaattggcggcccgctgatgggcggctttctggctgatcac
gtggggcttcgcgcggtgttcctcatcaccgccgtcctgctggtgatcagttttctggtg
acgctgtttctgattaaagagggcgcacgcccgagcgtgagcaaagcggagcgtctgagc
ggtaaggcggtatttgcgtcgttaccctatccctggctgatgattagcctgtttgtcacc
accatggtgatccagctctgcaatggttcggtcgggccgatcctcgcgctgtttattcag
tcgatggcgccagagagcagcaatattgccttcctcagcgggatgattgccgccgtgccg
ggcatttcggcgctgatgtctgccccacgtctgggcaagctgggggatcgcatcggcact
ggtcgcattctgatggcgacgcttgttgtggcggtggtcctctttttcgccatgtccttt
gtcaccacgcccttccagcttggggtgctgcgtttcctgctgggctttgccgatggtgcc
atgctgcctgcggtgcaaaccctgctgataaaatactccagcgatcgggtgaccgggcgc
atcttcggctataaccaatcgtttatgtatctggggaacgttgccgggccgttgatgggg
gcggcggtctcggcgatggccggattccgctgggtatttttcgccactgcggtggtgata
ttgctgaatattatccagcttgcatgggctatgcggcggcgtcgtcagcaggaagatcga
acgcgccagattaagcggttgtag

DBGET integrated database retrieval system