KEGG   Leclercia adecarboxylata: APT61_17600Help
Entry
APT61_17600       CDS       T04232                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lax  Leclercia adecarboxylata
Pathway
lax00473  D-Alanine metabolism
lax00550  Peptidoglycan biosynthesis
lax01100  Metabolic pathways
lax01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lax00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    APT61_17600
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    APT61_17600
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    APT61_17600
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lax01011]
    APT61_17600
Enzymes [BR:lax01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     APT61_17600
Peptidoglycan biosynthesis and degradation proteins [BR:lax01011]
 Precursor biosynthesis
  Amino acid ligase
   APT61_17600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 ATP-grasp_3 ATPgrasp_ST RimK PTS_2-RNA GARS_A
Motif
Other DBs
NCBI-ProteinID: ALZ98728
UniProt: A0A356XMU2
LinkDB All DBs
Position
3780119..3781219
Genome map
AA seq 366 aa AA seqDB search
MAKLRVGIVFGGKSAEHEVSLQSAKNIVNAIDKSRFEVVLLGIDKQGQWHINDEQGYLLN
ADDPAHIALNPSEISVATVPGVMEGQLINASTGQTLSSVDVIFPIVHGTLGEDGSLQGML
RMANLPFVGSDVLGSAACMDKDVTKRLLRDAGLNVAPFVTLTRANRDQHTFADLSARFGL
PLFVKPANQGSSVGVSKVNSEAQFSDAVRLAFTFDHKVVVEQGIKGREIECAVLGNDFPQ
ASTCGEVVLNSEFYSYDTKYIDDQGAQVVVPAVLDAEVNDAIRAIAIEAYQALGCRGMAR
VDVFLTADNRVVINEINTLPGFTNISMYPKLWQASGLSYPDLITRLIELALERHAADSAL
QVSVNG
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagttgcgggtaggtattgtctttgggggaaaatcagccgagcacgaagtgtcg
ctgcaatcggccaaaaatatcgttaacgcgattgataaaagccgctttgaggtcgtgctg
ttaggtattgataagcagggccagtggcacattaacgacgagcagggctatctgctcaac
gccgacgatccggcgcacatcgcgctgaatccgtctgagattagcgttgctaccgtgcca
ggcgtaatggaaggccaactgatcaatgccagtaccgggcagacgctttcgtctgtcgat
gtcattttcccgattgtccacggcacgctgggcgaagatggctccctgcaggggatgctg
cgaatggccaacctgccgtttgtcggctccgacgtgctcggctctgctgcctgcatggat
aaagacgtcaccaagcgcctgctgcgcgatgccgggctgaacgtggccccctttgtcacc
ctgacccgcgccaaccgcgaccaacacacctttgccgatcttagcgcccgctttggcctg
ccgctgttcgtcaaaccggcaaaccagggttcctccgtcggcgtcagcaaagtgaacagc
gaagcgcagttcagcgacgcggtacgtctggcgtttaccttcgatcacaaagtagtggtt
gagcagggaattaaagggcgtgagattgagtgtgcggtgctggggaatgatttcccgcag
gccagcacctgcggcgaagtggtgctgaacagcgagttctactcttacgataccaaatac
atcgacgaccagggcgcgcaggtggttgtacctgccgtgctggatgctgaggtcaacgac
gcgatccgcgccattgccatcgaggcctatcaggcgctgggctgtcgcggtatggcacgt
gtcgatgtcttcttaacggcggataatcgcgtcgtcatcaatgaaatcaacaccctgcca
ggcttcaccaacatcagtatgtacccgaaactgtggcaggccagcggcctcagctacccg
gatctgatcacccgcctgattgaactggcgctggaacggcatgccgctgacagcgcgctt
caggtttccgttaacggttaa

DBGET integrated database retrieval system