KEGG   Leclercia adecarboxylata: APT61_17690Help
Entry
APT61_17690       CDS       T04232                                 

Definition
(GenBank) iron ABC transporter permease
  KO
K02011  iron(III) transport system permease protein
Organism
lax  Leclercia adecarboxylata
Pathway
lax02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:lax00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    APT61_17690
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lax02000]
    APT61_17690
Transporters [BR:lax02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter
    APT61_17690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BPD_transp_1
Motif
Other DBs
NCBI-ProteinID: ALZ97745
LinkDB All DBs
Position
3801493..3803571
Genome map
AA seq 692 aa AA seqDB search
MSQTLALHPVKKRDAVFLWVFVGWLAFALLPSWSLDYGLLESTGDEILDAYSWSHFNVSW
LWYLLPTLLLVRPFSEAKREKRSRHYLDAGWALLCMAFVVISAILEGRGLGYATIVLFVA
LGAIMTLALTRLEWLGGDRFVIGSLIAIVALIGIFIVWPSIAIFIPMFTNDAGEFAPQAF
MNVLSQSHIIQVIINSILLSIAVGIGCTFFGLVLAIYTTRIARRSAIIGRIFSILPIVTP
PFVVGLGVTLMMGRSGYVTELMVDWFGLTNTNWLYGFTGIWLAQVLAFTPMAFMILDGAI
KTIHPSLEEASYTLRASRWQTFNGVFVPLLKPALANAFLIVIVQSLADFSNPLVLGGNFD
VLATQIYFYITGSQLDYQAASTLGAFLLLFSLLVFCIQYMWIGKRSYVTVSGKSYRGDVQ
PLPVTLVWSVIALLAVWIAFNALLYGSIFYGSFTVNWGVDYTLTLDNFIKLFGQGMSDGA
WPSLLDTLLYAGIAAPITAAFGLLIAWIVVRQQFKGKKTIEFTTMLCFAVPGTVAGVSYI
LAFNSAPVYLTGTAAIVIISMVMRNVPVGIRAGIAGLGQIDKSLDEASLSLRAGSLRTIT
HILLPLLRPAILSALIYSFVRAITTVSAIVFLVTPDTRVATAYILNRVEDGEYGVAIAYG
SILIVVMLAIIFLFDWLIGEARISRSKAKNQA
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagacactcgctcttcatcccgtgaaaaaacgggatgcggtcttcctttgggtt
ttcgttggctggctggcatttgccctgctgccgagctggagcctggattatggcctgctg
gaatccaccggcgacgagatcctcgatgcctatagctggtcgcactttaacgtcagctgg
ctgtggtatctgctccccactctgctgctggtacgtccgttcagcgaagcgaagcgcgaa
aagcgcagccgccactacctcgacgccggctgggcgctgctgtgcatggcctttgtggtc
atcagcgccatccttgaagggcgcggtttaggctatgccaccatcgtgctgtttgtggcg
ctgggggcgattatgacgctggccctgacccgtctcgaatggctggggggcgaccgcttt
gtgattggctcgctgatcgccatcgtcgcgctgatcggcatctttatcgtctggccgagc
atcgccatctttatcccgatgttcaccaacgacgcaggggaattcgccccgcaggcattc
atgaatgtgctgtcgcagtcgcacatcatccaggtgatcatcaactcgatcctgctctcc
attgcggtgggtatcggctgtaccttctttggcctggtgctggcgatctacaccacccgc
atcgccagacgtagcgccattattggccgcatcttctcgatcctgccgatcgtcaccccg
ccgttcgtggtgggcctgggcgtgacgctgatgatggggcgctccggctacgtcactgaa
ctgatggttgactggtttggcttaaccaacaccaactggctgtacgggtttaccggcatc
tggctggcgcaggtgctggccttcaccccgatggcgtttatgatcctcgatggcgcgatc
aagaccattcacccgtcgctggaagaggcttcgtataccctgcgcgccagccgctggcag
acctttaacggcgtctttgtcccgctgctgaaaccggcgctggcgaacgcctttttgatc
gtgattgtgcagtcgctggccgacttcagtaacccgctggtgctggggggcaacttcgac
gtgctggccacgcagatctacttctatatcaccggttctcagctggattaccaggcggcg
agcaccctgggcgccttcctgctgctgttctcgctgctggtgttctgcatccagtatatg
tggatcggcaaacgttcttacgtgaccgtctccggcaagtcctatcgcggcgacgtgcag
cccctgccggtgacgctggtgtggagcgtgatcgccctgctggcggtgtggatcgccttt
aacgccctgctctacggcagcattttctacggcagctttaccgtcaactggggggtggat
tacaccctgacgctggataactttatcaagctgttcggccaggggatgagcgatggcgca
tggccttcgctgctcgacaccctgctgtacgccgggatcgccgcaccgatcaccgccgcc
ttcggtttactgatcgcctggatcgtggtgcgccagcagttcaaaggcaaaaagaccatc
gagttcaccaccatgctgtgctttgccgttccgggcaccgtggcgggcgtgtcgtacatt
ctggcctttaacagcgcgccggtgtacctcacgggtaccgccgccatcgtcattatctcg
atggtgatgcgtaacgtgccggtgggtattcgcgccgggatcgcgggtctgggtcagatc
gacaaatcgctggacgaagcctcgctcagtctgcgggccgggtcgctgcgtaccatcacc
cacatcctgctgccgctgctgcgtccggccattttgtcggcgctgatctacagctttgtg
cgtgccattaccaccgtcagcgccattgtgttcctggtcaccccggatacccgggtagcc
acggcctacattctgaaccgcgtggaagatggcgaatacggcgtggcgattgcctacggc
tcgatcctgattgtggtcatgctggcgatcattttcctctttgactggctgatcggtgag
gcgcgtatctcccgttctaaagccaaaaaccaggcgtaa

DBGET integrated database retrieval system