KEGG   Lactobacillus amylovorus GRL1118: LAB52_06790Help
Entry
LAB52_06790       CDS       T01954                                 

Definition
(GenBank) serine-threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lay  Lactobacillus amylovorus GRL1118
Brite
KEGG Orthology (KO) [BR:lay00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lay01001]
    LAB52_06790
Enzymes [BR:lay01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     LAB52_06790
Protein kinases [BR:lay01001]
 Serine/threonine kinases: Other
  Bacterial family
   LAB52_06790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Haspin_kinase RIO1 Kinase-like Kdo Seadorna_VP7 FtsH_ext Pkinase_fungal Sulf_transp
Motif
Other DBs
NCBI-ProteinID: AEA32283
UniProt: F2M0S9
LinkDB All DBs
Position
complement(1330459..1332486)
Genome map
AA seq 675 aa AA seqDB search
MIDKGYLLGERYRIIDTLGEGGMANVYLAEDIILQRKVAVKILRLDLQNEPQTQARFQRE
ALATSELSHPNIVSVLDVGTDHGLPYMVMEYVDGPDLKEYIRENSPLDLREVIRIMDQIL
SAVALAHKHNVIHRDLKPQNILMDKRGNIKIADFGIAVALNQSSITQTNSVMGSVHYMSP
EQTRGGLVTKQSDIYSLGIILYELITGTVPFNGDTPVSVALKHAQEPIPSIRKKDKSVPQ
ALENVVLKATAKDPRDRYASAQVMKADLDSSLDPERSDEPIFVPNHGNSDDKTIVLPGFK
PQKTTAEESKKEEKSEVEETPKKEKKSFWQNVKAHKWWWIFSVIAAGLIIFIMIFALSGN
NQPKQVNVPDVTNIAENAAERRLEAAGLQVGKIIRRQSDDVKKGYVIATNPTAGNSLDRG
KSVNLIVSSGSSMVKVPDVVGDDYDKAAEKLENQGFDVVREDQFSSKITQGNIISQSIAA
GVEVKPTQTTITLVVSRGKAPRQRSNTVTLKDLHNYSLKSAQDYARDHGLTLQINQEYSD
DVEKGLIISMDPGPGTKVDRGSTIAIKVSRGPKEEKETTITKNFTVNYVGTADDSAGETD
NNKDEDSSSSKSSSTKGDHVQIYIKDDDHYLSNIYRDLYIKRDMSFSIPFSIKNGAGQLR
VVRNGETILNEKVTK
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgataaaggttatctgcttggagagcgctatcgcattattgatactttaggcgaa
ggcgggatggccaatgtttatctggctgaagatattattttacagcgtaaagttgctgtt
aaaatcttgcgcttagatttgcaaaatgaacctcaaacgcaagctcgcttccaaagagaa
gcattagctaccagtgagctaagtcatcctaatattgtctcagttcttgatgttggtacg
gatcatggacttccttatatggtaatggaatatgtcgacggtcctgatttaaaagaatat
atccgtgaaaattctccattagatttgcgtgaagtaattcgcatcatggatcaaatttta
agtgcggtagctcttgctcacaagcataatgtgattcaccgagacttaaagccacaaaat
atcttaatggataaaagaggtaatattaaaatcgccgattttggtattgcagtagcgctt
aaccaaagctcaattacgcaaactaattcagtgatgggttctgtccattacatgtcacca
gaacaaacaagaggaggattggttactaagcaatccgacatttattctcttgggatcatt
ctttatgaattgattacaggtactgtgccatttaatggggatacgcctgtttctgttgct
ttaaaacatgctcaagaacctattccttcaattagaaagaaagacaagagcgttccgcaa
gcattagagaatgtcgttttaaaggcgacagctaaggatccacgtgatcgttacgcttct
gctcaagtaatgaaggcagatcttgatagcagtcttgatcccgaacgaagcgatgaacca
atctttgttccgaatcacggcaatagcgatgataaaaccatcgttttaccaggatttaaa
ccacaaaagactactgctgaggaatccaagaaagaggaaaaatcagaggtagaagaaaca
cctaagaaagaaaaaaagagcttttggcagaatgttaaagctcataaatggtggtggatc
ttttctgtgattgccgctgggttgattattttcattatgatttttgctttaagcggcaat
aatcaacccaagcaagtcaatgtccctgatgtaaccaacattgctgagaatgcagcggag
agaaggttagaagctgctggcttgcaagtgggtaaaattattcgacgtcaatctgatgat
gttaaaaagggctatgtcattgccactaatccgacggctggcaattctcttgatcgagga
aaatctgtcaatttgatcgtttctagcggttcaagcatggtaaaggtgcctgacgtagta
ggcgatgattatgataaggccgctgagaagttagaaaatcagggcttcgatgtggttaga
gaagatcaattctcaagcaagattactcaaggcaacatcatttcgcaaagtattgctgcc
ggggttgaagttaagccaacgcaaactacaattactttggtagtttctagaggtaaggct
ccacgtcaaagaagtaatacggtgacattgaaagatttgcataattactcattaaagagt
gctcaagattatgcaagagatcatggtttaactttgcagattaatcaagagtactctgat
gatgtcgaaaaaggcttaatcatttcaatggatccaggtcctggaacaaaagttgatcgt
ggctcaaccattgcaattaaggtttctcgtggacccaaggaagaaaaagagaccacaata
actaagaactttaccgtaaactatgttgggacagcagacgacagtgctggagaaacagat
aataataaagatgaagacagttcatccagcaagtcaagttctactaagggcgatcatgtt
cagatctatattaaggacgacgatcactacttaagcaatatttaccgtgatctttatatt
aaacgtgatatgagcttctcaattccattttcaattaagaatggtgcaggacaattaaga
gtagtccgcaatggagaaactatcttgaatgaaaaggtgactaaataa

DBGET integrated database retrieval system