KEGG   Lelliottia amnigena: A8A57_03920Help
Entry
A8A57_03920       CDS       T04400                                 

Definition
(GenBank) penicillin-binding protein 1B
  KO
K05365  penicillin-binding protein 1B [EC:2.4.1.129 3.4.16.4]
Organism
laz  Lelliottia amnigena
Pathway
laz00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:laz00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A8A57_03920
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:laz01003]
    A8A57_03920
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:laz01011]
    A8A57_03920
Enzymes [BR:laz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     A8A57_03920
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     A8A57_03920
Glycosyltransferases [BR:laz01003]
 Polysaccharide
  Bacterial polysaccharide
   A8A57_03920
Peptidoglycan biosynthesis and degradation proteins [BR:laz01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   A8A57_03920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PBP1_TM Transpeptidase UB2H UvrB_inter DUF3484
Motif
Other DBs
NCBI-ProteinID: ANG91588
UniProt: A0A1A9F7D1
LinkDB All DBs
Position
850277..852799
Genome map
AA seq 840 aa AA seqDB search
MAGNDREPIGRKGKPARPAKEKVSRRRLRDEDYDDDYEDDYEDEEPMPRKGKGKGRKPRG
KRGWFWLLLKLFIVFVVLMAIYGVYLDQKIRSRIDGKVWQLPAAVYGRMVNLEPDMSISK
NEMVKLLEATQYRQVTKMTRPGEFTVQAKSIEMIRRPFDFPDSKEGQVRARLVFDGDHLE
TIENLDNNRQFGFFRLDPRLITMLSSANGEQRLFVARNGFPDLLVDTLLATEDRHFYEHD
GISLYSIGRAVLANLTAGRTVQGASTLTQQLVKNLFLSSERSYWRKANEAYMALLMDARY
SKDRILELYMNEVYLGQSGDNEIRGFPLASLYYFGRPVEELSLDQQALLVGMVKGASIYN
PWRNPKLALERRNLVLRLLQQQQVIDQELYDMLSARPLGVQPRGGVISPQPAFMQMVRQE
LQSKLGDKVKDLSGVKIFTTFDSVAQDAAEKAAVDGIPVLKKQRKLSDLETAMVVVDRNS
GEVRAMVGGAEPQYAGYNRAMQARRSIGSLAKPATYLTALSQPNQYRLNTWIADAPISLR
QPNGQVWSPQNDDKQFSGQVMLVDALTRSMNVPTVNLGMALGLPAITDTWQKLGVPKDQL
HPVPAMILGALNLTPIEVAQAFQTIASGGNRAQLSALRSVIAEDGSVLYQSYPQAERVVP
AQAAYMTLWTMQQVVQRGTGRQLGAKYPGLHLAGKTGTTNNNVDTWFAGIDGREVVITWV
GRDNNQPTKLYGASGAMSIYQRYLANQSPVPLNLTPPEDIVDMGVDEAGNFVCGGGMRSL
PVWTSNPDSLCQQSQPEQPTGNPFDQSSQPQQPQQQQQPQNEKKDSDGVAGWIKDMFGGN
NT seq 2523 nt NT seq  +upstreamnt  +downstreamnt
atggcggggaatgaccgcgagccaataggacgtaaggggaaacctgcgcgtccggccaaa
gaaaaagtgagccgtcgtcgcctcagagatgaggattatgacgatgactatgaagatgat
tatgaggatgaagaaccgatgccgcgtaaagggaaaggcaaagggcgtaagcctcggggc
aagcgcggctggttctggctgctgctgaagctgttcattgtatttgttgtgctgatggcc
atttacggcgtctatctggatcagaaaatccgcagccgtattgatggtaaagtctggcag
ttgcctgcggcggtttatggtcgcatggtcaaccttgagccggatatgtccatcagtaaa
aacgagatggtgaaactgctcgaagccactcagtatcgtcaggtgacgaaaatgacgcgc
ccgggcgagtttaccgtgcaggcgaaaagcatcgagatgattcgccgtccgtttgatttc
cctgacagcaaagagggccaggtgcgtgcgcgtctggtctttgatggcgatcatctggag
acgatagagaacctggacaataaccgccagttcggtttcttccgtcttgatcctcgcctg
attaccatgctctcctcggcgaatggcgaacagcgtctgttcgtggcgcgtaacggcttc
ccggatctgctggtggatacgctgctggcaaccgaagaccgtcacttctacgagcacgac
gggattagcctgtattccattggccgcgcggtgctggcaaacttgaccgccggtcgcacg
gtacagggggcgagtacgctgacccagcagctggtgaagaacctgttcctctccagcgag
cgctcttactggcgtaaagccaatgaagcgtacatggcgctgttgatggatgctcgctac
agcaaagatcgcattcttgaactgtacatgaacgaggtgtatctcggtcaaagcggcgat
aacgagatccgcggtttcccgctggcgagcctgtactattttggtcgcccggtggaagag
ctgagcctcgatcagcaggcgctgttagtgggtatggtaaaaggcgcttcgatttacaac
ccgtggcgtaacccgaaactggcgctcgagcgtcgtaacctggtcctgcgtctgctgcaa
caacagcaggttatcgatcaggagctgtacgacatgttaagcgcgcgcccgctgggcgtt
cagccgcgtggtggcgtgatctcgccgcagcctgcctttatgcagatggtccgtcaggag
ctgcaaagcaagctgggcgacaaggtgaaagatctctccggcgtgaagatctttaccacc
tttgattcggtggcgcaggacgctgctgagaaagcggccgtggacggtatacctgtcctt
aagaaacaacgtaagttgagcgatctggaaaccgcaatggtggtggttgacagaaatagc
ggcgaagtgcgcgcgatggtgggcggggctgaaccgcagtacgccggctataaccgtgcg
atgcaggcgcggcgttcgattggttccctggcaaaacccgcgacctatctaaccgcgctc
agccagcctaatcagtatcgcctgaatacctggattgccgatgcgccaatctccctgcgc
cagcctaatggccaggtctggtctccgcagaacgacgataaacagttcagcggacaggtt
atgctggtggatgcgttaacccgctccatgaacgtgccgacggtaaaccttgggatggcg
ctgggtctgcctgcgattaccgatacctggcagaagctcggtgtgccaaaagatcagctg
cacccggtgccagcgatgatcctgggggcactgaacctgacgccaatcgaagtggcgcag
gccttccagacgatcgccagcggcggtaaccgtgcacagctttctgcactgcgttccgtg
attgccgaagacggcagcgtgctctaccagagctatccgcaggcggagcgcgtcgttccg
gcacaggcggcctatatgacgctctggaccatgcagcaggttgtgcagcgcggcaccggt
cgacagcttggcgcgaaatacccgggtctgcatctggccggtaaaacaggcaccacaaac
aacaacgttgatacctggtttgccggtatcgacgggcgtgaagtggtcattacctgggtt
ggacgcgataacaaccagccgaccaaactgtatggcgcaagcggtgcgatgtcgatctat
cagcgatatctggcgaaccagtcgcctgtaccgctgaacctgacgccaccggaagacatt
gtggacatgggcgtggatgaagccggtaacttcgtttgcggcggcgggatgcgttccctg
ccggtctggacgtcgaatcctgactccctctgccagcaaagtcagccagagcagccgacc
ggtaatccgttcgatcagtcttctcagcctcagcagccgcagcaacagcaacagccgcag
aatgagaaaaaagacagcgacggtgtcgcgggttggatcaaagatatgtttggcggtaac
taa

DBGET integrated database retrieval system