KEGG   Lelliottia amnigena: A8A57_04505Help
Entry
A8A57_04505       CDS       T04400                                 

Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
laz  Lelliottia amnigena
Pathway
laz00473  D-Alanine metabolism
laz00550  Peptidoglycan biosynthesis
laz01100  Metabolic pathways
laz01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:laz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    A8A57_04505
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A8A57_04505
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    A8A57_04505
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:laz01011]
    A8A57_04505
Enzymes [BR:laz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     A8A57_04505
Peptidoglycan biosynthesis and degradation proteins [BR:laz01011]
 Precursor biosynthesis
  Amino acid ligase
   A8A57_04505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST ATP-grasp_4 RimK
Motif
Other DBs
NCBI-ProteinID: ANG91694
UniProt: A0A1A9F8H2
LinkDB All DBs
Position
complement(983249..984349)
Genome map
AA seq 366 aa AA seqDB search
MAKQRVGIVFGGKSAEHEVSLQSAKNIVDAIDKNRFDIVLLGIDKQGQWHVNDASQYLLN
ADDPAHIALNPSDVSVATVPGVAQGQLIDAGNASALAQIDVIFPIVHGTLGEDGSLQGML
RMANLPFVGSDVLGSAACMDKDVTKRLLRDAGLNIAPFVTLTRANRDKHSFAQIAGQLGL
PLFVKPANQGSSVGVSKVTCEAQFAEAVDLAFEFDRKVVVEQGIQGREIECAVLGNDFPE
ASTCGEVVLNSDFYSYDTKYIDDVGAQVVVPAVLDPDVNDKIRAIAIEAYKALGCEGMAR
VDVFLTPDNEVVINEINTLPGFTNISMYPKLWQASGLSYPALITRLIELALERHAVNSAL
KNSVSG
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcagcgggttggaattgtctttgggggaaaatcggcggaacacgaagtatca
ctgcaatcggccaaaaatattgtcgatgccattgataaaaaccgtttcgatattgtcctg
ttagggattgataaacagggtcagtggcacgtcaacgatgccagccagtatctgttgaat
gcagacgatccggcgcatatcgccctcaatccctccgacgtaagtgtggccaccgtgcct
ggcgtggcgcaagggcagctgatcgatgctggaaatgcctcggcgctggcgcagattgac
gttatcttcccgattgtccacggcacgctgggggaagatggttcgctgcagggaatgttg
cgaatggcaaatttacccttcgtgggatcggatgttctgggttctgccgcctgcatggat
aaagacgtgaccaagcgtctgctccgcgatgccggactgaatatcgcgccgtttgtaacg
ttaacccgtgccaatcgggataaacacagcttcgcacagatcgccggccagttaggcttg
ccgctgtttgtgaagcccgctaaccagggctcttccgtcggcgtaagcaaagtcacttgc
gaggcgcagtttgccgaggccgtggatctggcgtttgaattcgatcgcaaagtggtggtt
gagcagggtattcagggccgtgaaattgagtgcgccgtgctgggaaatgatttcccggag
gccagcacctgcggcgaagtcgtattaaacagcgatttctactcatacgacactaaatac
atcgatgacgtgggggcgcaggttgtggtcccggcagtactggatcccgacgtgaatgac
aagatccgggcgatcgctatcgaagcctataaagcgctgggttgcgaaggcatggcgcga
gtggatgtcttcctgacgcctgataacgaggtggtgatcaacgagatcaataccttaccc
gggttcaccaacatcagcatgtacccaaaattatggcaggcgagcggccttagctacccg
gcactcattacccgtctgattgaactggcgctggagcgtcacgccgtcaacagcgccctg
aaaaactccgttagcggttaa

DBGET integrated database retrieval system