KEGG   Lelliottia amnigena: A8A57_04525Help
Entry
A8A57_04525       CDS       T04400                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
laz  Lelliottia amnigena
Pathway
laz00730  Thiamine metabolism
laz00790  Folate biosynthesis
laz01100  Metabolic pathways
laz02020  Two-component system
Module
laz_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:laz00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    A8A57_04525
   00790 Folate biosynthesis
    A8A57_04525
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A8A57_04525
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:laz04147]
    A8A57_04525
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:laz00537]
    A8A57_04525
Enzymes [BR:laz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     A8A57_04525
Exosome [BR:laz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A8A57_04525
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:laz00537]
 Enzymes
  A8A57_04525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Phosphodiest Sulfatase PT-VENN
Motif
Other DBs
NCBI-ProteinID: ANG91698
UniProt: A0A1A9F7N2
LinkDB All DBs
Position
987103..988518
Genome map
AA seq 471 aa AA seqDB search
MKQSALTIALIPLLFTSAVYAETTQTSVLENRAAQGNITEPGGARRLSGNQTAAIRASLN
DKTAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALDKKTGKPDY
VTDSAASATAWTTGVKTYNGALGVDIHEKDHQTLLELAKTAGLATGNVSTAELQDATPAA
LVAHVTSRKCYAPSITTEKCPTNALEKGGKGSITEQLLNARADVTLGGGAKSFQESATSG
EWQGKTLREQAQVRGYQMVSDAASLEAITEANQDKPLLGLFSEGNMPVRWQGPKASYHGN
LDKPAVTCTANPERNASVPTLAAMTEKAISLLSKNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQKALEFAKKDGNTLVIVTADHAHASQIVAPDTKAPGLTQALNTKDGAVM
VMSYGNSEEDSMEHTGAQLRIAAYGPHAANVVGLTDQTDLFYTMKAALNLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacagagcgcactgactatcgcattaattccgttattatttacttcggccgtttat
gctgaaacgacccagaccagcgtgctggaaaaccgggctgctcaggggaatattaccgag
cctggcggcgcacgtcgtctttcaggcaatcagacggctgccattcgcgcatcgctcaat
gataaaacggctaagaatattattctgctcattggcgatggcatgggggattctgaaatt
accgctgcgcgaaattacgctgaaggcgcaggtggtttcttcaaaggtattgatgcttta
ccgttgaccgggcaatacacgcattatgcgctcgataaaaaaaccggcaaacccgattac
gttaccgattcggcggcctcggccaccgcgtggacaaccggcgtaaaaacctataacggc
gcgctcggcgtcgatattcacgaaaaagatcatcaaacccttcttgaactggcaaaaaca
gccggactggcaacgggcaatgtctcaaccgctgagcttcaggatgcgacgcctgcggcg
ctggtggcccacgtgacttcacgtaaatgctacgcgccgtcgatcacgaccgaaaaatgc
ccgaccaacgccctggaaaaaggcggcaaaggctcgattaccgagcaattgctgaatgca
cgcgccgatgtcacattgggcggcggcgcgaagagcttccaggagagcgccacgtcaggc
gagtggcagggtaaaacgctgcgtgaacaggcacaggtaagaggctatcagatggtcagc
gatgcggcttctctggaggcgattaccgaagcgaatcaggataaaccgctgctgggtctg
ttctctgagggcaatatgcccgttcgctggcaaggacctaaagcctcttatcatggcaac
ctggataaaccggcggtgacctgtacggccaatccggaacgtaacgccagcgtcccgacg
cttgctgccatgaccgagaaagccatctccctgctcagtaagaacgaaaaagggttcttc
ctgcaggtagaaggggcctccatcgacaagcaggatcacgcggcaaatccgtgcgggcag
attggcgaaacggtcgatcttgatgaagccgtacaaaaggctctggaatttgccaaaaaa
gacgggaataccctggtcattgtcacggctgaccacgctcacgccagccagattgtggcg
ccggataccaaggcaccaggcctgacgcaggcgttgaataccaaagacggtgcggtaatg
gtgatgagctacggcaattccgaagaggattctatggaacataccggtgcgcagttacgc
atcgcggcctatggtcctcatgcagctaacgtagtaggactgaccgatcagaccgatttg
ttctacaccatgaaagcggcgcttaacctgaaataa

DBGET integrated database retrieval system