KEGG   Lelliottia amnigena: A8A57_05705Help
Entry
A8A57_05705       CDS       T04400                                 

Definition
(GenBank) erythritol/L-threitol dehydrogenase
  KO
K23271  erythritol/L-threitol dehydrogenase [EC:1.1.1.-]
Organism
laz  Lelliottia amnigena
Brite
KEGG Orthology (KO) [BR:laz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A8A57_05705
Enzymes [BR:laz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     A8A57_05705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C FAM72 Cpn10 TrkA_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ANG91924
UniProt: A0A1A9F965
LinkDB All DBs
Position
1243669..1244790
Genome map
AA seq 373 aa AA seqDB search
MQLHSYRNVAVNLKPAHIKQLVNFGPHDYRLITSLLPEPQHNELLVKIGACGICASDFHC
YHGAPMFWGNETFPAYVKTPVVSGHEFFGTVVAAGPNALEHFGVEEGDRVIAEQIVPCNT
CRFCRNGQYWMCEKHDIYGFQKQDADGGMTEYMLFKPTSRVHKIPFSLSLEECALIEPFS
CSVHAVNRGDIQFNDVVVLAGAGTLGLGMVQAIKLKTPKKLIVIDTMPYRLALAKKLGAD
VVLNPLEDDVIAEVKALTDGYGCDVYIEASGNPAGVTQGLQMIRKLGRFVEFSVFSRETT
VDWSIIGDRKELDIRGAHLSPGCYETVIDLFSRKLLTAEGIVTHKFPLDRWENAFETFGT
PEAVKVLLIPHAE
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgcaacttcattcgtacaggaacgtcgctgtgaaccttaaacctgcgcatatcaaacag
ctggtcaattttggccctcacgattaccgtttaatcacttcgctattgccggaaccgcaa
cacaatgaattgctggtgaaaataggggcgtgcggcatctgcgcgtctgattttcattgt
taccacggtgcgcccatgttctggggcaatgaaacattcccagcgtatgtaaaaaccccg
gtggtcagcggccatgagtttttcggtacggtggttgctgcaggtccgaatgcgcttgag
cacttcggcgttgaagagggcgaccgggttatcgccgagcaaattgttccctgcaacacg
tgccgcttctgtcgtaacggacagtactggatgtgcgaaaaacacgatatctatggtttt
cagaaacaggacgctgacggcggcatgactgaatacatgttatttaagccaacgagtcgg
gtgcataaaatacccttctcgctttctctggaagagtgcgcgctcatcgaacctttttcc
tgttccgtacacgccgtaaaccggggagatatccagtttaatgatgtggttgttctcgcc
ggggccggaacacttgggctgggcatggtacaagccataaagctcaagaccccgaaaaag
ctgatcgttatcgataccatgccttatcgcctggcactggcgaaaaaactcggcgcggat
gtggtgctgaacccgcttgaagacgacgtcatcgcggaagtgaaagccctgacagacggc
tatggttgtgatgtgtatatcgaagcttcaggtaatcctgccggggttacgcaggggcta
cagatgattcgcaaactggggcgcttcgttgagttcagtgtgttcagtcgcgaaacaacc
gtggactggtcgatcattggcgatcgcaaagagctggatattcgtggcgcgcatctaagc
cccggctgctacgagaccgtgattgacctgttcagtcgcaaactgctcaccgctgaaggg
attgtgacgcataaattcccgctcgatcgctgggagaacgccttcgaaaccttcggaacc
ccagaggcggtaaaagtgctgctgatcccgcacgcggagtaa

DBGET integrated database retrieval system