KEGG   Lelliottia amnigena: A8A57_06050Help
Entry
A8A57_06050       CDS       T04400                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
laz  Lelliottia amnigena
Brite
KEGG Orthology (KO) [BR:laz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A8A57_06050
Enzymes [BR:laz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     A8A57_06050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 Thioredoxin_3 HI0933_like FAD_oxidored NAD_binding_8 Thi4 FAD_binding_3 K_oxygenase Glutaredoxin AlaDh_PNT_C DAO FMO-like LpxI_N
Motif
Other DBs
NCBI-ProteinID: ANG91989
UniProt: A0A1A9F8L5
LinkDB All DBs
Position
1315001..1316566
Genome map
AA seq 521 aa AA seqDB search
MLDTNMKTQLKAYLEKLTKPVELIATLDDSAKSAEIRDLLAEIADLSPKVTFKEDNSLAV
RKPSFLIANPGSDQGPRFAGSPLGHEFTSLVLALLWTGGHPSKEAQALLEQIRDIDGDFE
FETYYSLSCHNCPDVVQALNLMSVLNPRIKHTAIDGGVFQNEITERNVMGVPAVYLNGQA
FGQGRMTLTEIVAKVDTGAEKRAAEELNKRDAYDVLIVGSGPAGAAAAIYSARKGIRTGL
MGERFGGQVLDTVDIENYISVPKTEGQKLAGALKAHVDDYQVDVIDSQSASKLIPAATEG
GLHQIETASGAVLKARSVIVATGAKWRNMNVPGEDQYRTKGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVEHVTLLEFAPDMKADQVLQDKVRSLNNVDIILNAQTTEVKGD
GTKVTGLEYRDRVSGDVHSVALSGIFVQIGLLPNTTWLEGAIERNRMGEIIIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSSFDYLIRTKTA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacactaatatgaaaacccagctcaaagcctaccttgagaaattgaccaaaccg
gtagagttaattgccacgctggatgacagcgcgaaatcggcagagatccgggatttgctg
gcggagatcgctgacctgtcaccgaaagtgacctttaaagaagataacagcctggcggta
cgtaagccctctttcctgatcgccaatccgggttccgatcaggggccacgctttgccggt
tctccgctggggcacgaatttacgtcactggtactggctctgctgtggaccggtggacat
ccgtcaaaagaggcgcaggctctgcttgagcagatccgcgatatcgacggtgattttgaa
tttgaaacctattattcgctctcctgccacaactgcccggacgtggtgcaggcgctgaac
ctgatgtcggtgctgaacccgcgtatcaagcatactgcaattgacggcggtgttttccag
aacgaaatcactgaacgtaatgtgatgggcgttccggcggtctacctgaacggacaagcg
ttcggccaggggcgtatgacgctgactgaaatcgtggctaaagtggataccggtgctgaa
aaacgcgcagcggaagaactcaacaaacgcgatgcgtatgacgtgctgattgtgggttcc
ggcccggcaggggcggcggcagcgatttactccgcccgtaaaggcattcgtaccggtctg
atgggtgaacgtttcggcggccaggtgctggataccgtcgatatcgagaactacatttcc
gtcccgaaaacagaaggtcagaaactggcgggggcattgaaagcccacgtggatgattat
caggtcgacgtgattgacagccaaagcgccagcaaactgattccggcggcaaccgaaggc
ggcctgcatcagattgaaaccgcctcgggtgcggtgctgaaagcgcgtagcgtgatcgtg
gcgaccggcgcgaagtggcgcaatatgaacgtgcctggtgaagatcagtatcggacgaaa
ggcgtaacctactgcccgcactgcgacggtccgctgtttaaaggtaaacgcgtggcggtg
attggcggcggtaactccggcgtcgaagcggcaatcgacctggctgggattgttgagcac
gtcactctgctggaatttgccccggacatgaaagccgaccaggttctgcaggataaagtg
cgtagcctgaataacgtcgatatcattttgaatgcgcaaaccacggaagtgaaaggcgac
ggcacaaaagtgaccggcctggaataccgtgaccgcgtgagcggggatgtccacagcgtc
gcgctgtcgggtatctttgtgcagattggtctgctgccaaataccacctggctggaaggc
gccattgagcgtaaccgtatgggtgaaatcatcatcgacgcgaagtgtgaaaccagcgtg
aagggtgtgtttgcggcgggagactgcaccacggtgccgtacaagcagattatcattgca
acaggtgaaggggcgaaagcctcactgagttccttcgactacctgattcgcacgaaaacc
gcataa

DBGET integrated database retrieval system