KEGG   Lelliottia amnigena: A8A57_09540Help
Entry
A8A57_09540       CDS       T04400                                 

Definition
(GenBank) glutathione transferase GstA
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
laz  Lelliottia amnigena
Pathway
laz00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:laz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A8A57_09540
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:laz02000]
    A8A57_09540
Enzymes [BR:laz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     A8A57_09540
Transporters [BR:laz02000]
 Other Transporters
  Pores ion channels [TC:1]
   A8A57_09540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_2 GST_C_3 GST_N_2 GST_N_3 GST_N GST_C_6
Motif
Other DBs
NCBI-ProteinID: ANG92631
UniProt: A0A1A9FA87
LinkDB All DBs
Position
complement(2039551..2040156)
Genome map
AA seq 201 aa AA seqDB search
MKLFYKPGACSLASHITLRESGKDFTLDGVDLMKKRLENGDDFLAINPKGQVPALLLDDA
TLLTEGVAIMQYLADTVPDRQLLAPAGSIARYKTLEWLNYIATELHKGFTPLFRPDTPEE
YKPTVRTMLEKKLQYIDESLKDDQWICGPRFTIADAYLFTVLRWARAVKLNMDGLDHIAA
YMARVEERPAVAAALKAEGLN
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctacaaaccgggtgcctgttcgcttgcttcacacatcacactgcgcgag
agcggtaaagattttacgctcgatggcgtcgacctgatgaaaaagcgccttgaaaacggc
gatgacttcctcgcaattaacccgaagggacaggttcccgctctcttgctggatgacgct
acgctgcttaccgaaggcgtcgccattatgcaatatctggctgacaccgtccccgatcgt
cagctactggcacctgccggcagcattgcgcgttataagacgctggaatggctcaactac
attgcaaccgaactgcataaaggttttacgccgctgttccgcccggatacgccagaagag
tacaaacccaccgtgcgtacgatgctggagaaaaagctgcagtatattgatgagtcattg
aaagacgatcagtggatttgtggcccacgcttcacgattgccgatgcgtatctgtttacg
gttctgcgctgggcgcgtgcggtgaaactgaatatggacgggttagatcatatcgcggca
tatatggcacgtgttgaagaacgcccggccgttgccgcggcgctgaaagcggaagggctt
aactaa

DBGET integrated database retrieval system