KEGG   Lelliottia amnigena: A8A57_13385Help
Entry
A8A57_13385       CDS       T04400                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
laz  Lelliottia amnigena
Pathway
laz00500  Starch and sucrose metabolism
laz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:laz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A8A57_13385
Enzymes [BR:laz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     A8A57_13385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C CdhD
Motif
Other DBs
NCBI-ProteinID: ANG93337
UniProt: A0A1A9FDV8
LinkDB All DBs
Position
2846949..2848436
Genome map
AA seq 495 aa AA seqDB search
MKNPTLLQCFHWYYPTGGGLWQEVTALAPNLNEIGINMIWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQKGSVATKYGDKAQLLEAIAALKANDIAVLLDVVVNHKMGADEKEPVSVQSV
NEQDRTQIDDDVIECEAWTRYTFPARAGKYSQFIWDYKCFSGVDHIENPDQDGIFKIVND
YTGEGWNEQVDDEMGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTECDGFRLDAVKHI
PAWFFKEWIEHVQEVADKPLFIVAEYWSHEVDKLQQYIDQVEGKTMLFDAPLQMKFHDAS
RQGRDYDMSQIFTGTLVEADPFHAVTLVANHDTQPLQALEAPVEAWFKPLAYALILLREN
GVPSVFYPDLFGASYEDTGGDGETYQIEMPIIEQLHELILARQRFAHGVQTLYFDHPNCI
AFSRSGTDEAPGCVVVMSNGDDGEKTICLGENYGDKNWRDFLGNREEIVTTGSDGEGIFT
CNGGSVSIWVMEDVL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccccacgctattacaatgctttcactggtattaccccacgggtggcgggtta
tggcaggaagtaaccgcactggcacccaacctgaatgaaatcggcatcaacatgatctgg
ttacccccggcgtacaaaggtgcatcgggcggttattctgtcgggtatgactcttacgat
ctctttgacctgggcgaatttgaccaaaaaggctccgtcgcgaccaaatacggtgacaag
gcgcagttgcttgaagccattgcggcgttaaaagcgaacgacatcgcggtgctgctcgac
gtggtggtgaaccacaagatgggcgccgatgaaaaagagccggtcagcgtacaaagcgtc
aatgagcaggaccgcacgcaaatcgatgacgacgtgatcgaatgcgaagcctggacgcgt
tacaccttccctgcccgcgcaggcaagtactctcagtttatctgggattacaaatgcttt
agcggcgttgaccatatcgaaaaccccgaccaggacggcatcttcaagattgttaacgac
tatacgggcgaaggctggaacgagcaggtcgacgacgaaatgggtaatttcgattacctg
atgggcgaaaacatcgacttccgtaaccacgcggtgaccgaggagatcaaatactgggcg
cgttgggtgatggagcaaaccgagtgcgatggtttccgtctcgatgcggtcaaacatatt
cctgcctggttcttcaaagagtggattgaacacgtccaggaagtggcggacaagccgctg
tttatcgtggcggaatactggtcgcacgaagtcgacaaactgcagcagtatatcgatcag
gtcgaaggtaaaaccatgctgttcgacgccccgctgcagatgaaattccacgatgcctcg
cgtcagggtcgggattacgacatgagtcaaatcttcaccggcacgctggtggaagccgat
ccgttccacgcggtgacgctggtcgcaaaccacgatacgcagccgctccaggcgcttgaa
gcccccgtcgaagcctggtttaaacctctcgcctatgcgctgatcctgctgcgcgaaaac
ggcgtcccgagcgtcttctatccggatttattcggcgccagctatgaagataccggcggc
gacggcgaaacctaccagatcgagatgcccattattgagcaactgcacgaactgatactg
gcccgtcagcgtttcgcccacggcgtccaaacgctctatttcgatcatcctaactgcatt
gcctttagccgcagcggaaccgatgaagcaccggggtgtgtggtggtcatgtccaacggc
gatgacggcgaaaaaaccatctgcctgggggaaaactacggagataaaaactggcgtgat
ttccttggcaatcgcgaagagatcgtcaccaccggatccgatggtgaagggatcttcacc
tgcaacggcggcagcgtcagtatctgggtaatggaagacgtgttataa

DBGET integrated database retrieval system