KEGG   Lelliottia amnigena: A8A57_14570Help
Entry
A8A57_14570       CDS       T04400                                 

Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
laz  Lelliottia amnigena
Pathway
laz00564  Glycerophospholipid metabolism
laz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:laz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    A8A57_14570
Enzymes [BR:laz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     A8A57_14570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_binding_3 FAD_oxidored DAO_C Pyr_redox_2 NAD_binding_8 3HCDH_N Thi4 Pyr_redox HI0933_like Pyr_redox_3 Lycopene_cycl GIDA
Motif
Other DBs
NCBI-ProteinID: ANG93553
UniProt: A0A1A9FEG8
LinkDB All DBs
Position
3127093..3128721
Genome map
AA seq 542 aa AA seqDB search
MTLRDPRYSDVIIIGGGATGAGIARDCALRGLSVTLLERHDIATGATGRNHGLLHSGARY
AVTDGESAKECIAENRILRRIARHCIEPTEGLFITLPEDDLAFQQTFITACTRAGIQAQA
LDPAQAIRMEPAVNPALIGAVKVPDGTVDPFRLTAANMLDAREHGATILTAHEVTGLIRE
GDTVRGVRVYDTLYGEHSELYASVVVNAAGIWGQRIAEYAALSVRMFPAKGSLLILDHRI
NNYVINRCRKPADADILVPGDTISLIGTTSTHIDYNEIDCNRVTAEEVDILLREGEKLAP
VMSQTRILRAYSGVRPLVASDNDPSGRNVSRGIVLLDHAVRDGMEGFITITGGKLMTYRL
MSEWATDAVCQKLGNTQPCTTAERPLPGSQESAEKTLHKIISLPAPLRGSAIYRHGDRTP
AWLGQNRLSRSLVCECEAVTAGEVQYAVENLAVNNLLDLRRRTRTGMGTCQGELCACRAA
GLLQRFNVTTSAQSLTQLSEFLNERWKGVQPVAWGDALRESEFTRWVYQGLCGLEKEPHH
EV
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgactctccgtgaccctcgttacagcgatgtcatcatcattggcggcggcgcaacgggc
gcaggtattgctcgcgattgcgcgctgcgcggcttaagcgtgacgctgctggaacgccat
gacattgccaccggcgcgaccggaagaaatcacggcctgctgcacagcggcgcccgctat
gccgtcaccgacggcgaatccgctaaagagtgcatcgcagaaaatcgcatcctcaggcgt
atcgctcgccactgcattgaacccacggaaggcctgtttattaccctgccggaagacgat
ctcgcctttcagcaaacctttatcactgcctgcacccgggcgggaattcaggcgcaggcg
cttgacccggcacaggcaataagaatggagcctgcggtcaatccggcgcttatcggcgcg
gtcaaggtaccggacggcaccgtggatcctttccgtctgacggcggccaacatgctcgac
gcccgcgagcacggggcgaccatcctcaccgcgcatgaagtgacgggtttgattcgcgag
ggggataccgtgcgcggcgtgcgggtatacgacacgctctatggcgaacacagcgagctg
tatgccagcgtggtggtcaatgcagcggggatatggggacaacgtatcgccgaatacgcc
gcgctctctgtgcgcatgttcccggcgaaaggctcgctgctgatcctcgatcatcgcatc
aacaactatgtcattaaccgctgccgcaaacctgctgatgccgatattctggtgcctggc
gataccatctcgctcattggcaccacctccacccatatcgattacaacgagattgactgc
aatcgcgtcacggccgaagaggtggatattttgctgcgcgaaggggaaaaactggcgccc
gtcatgtcgcaaacccggatcctgcgggcctactcgggcgtacgtcccctggtggccagc
gataacgacccgagcgggcgaaacgtcagccgcggcatcgtgctgctcgatcatgcggtc
cgtgacgggatggaaggctttatcaccatcaccggcggcaaattaatgacctatcggctg
atgtccgagtgggcgaccgacgcggtgtgtcaaaaactgggcaatacgcagccgtgtacc
accgctgaacgtcctctgcccggttcacaggaatccgccgaaaaaacgctgcataaaatc
atctctctgcccgcgccgctgcgcggctccgcaatctatcgtcatggcgatcgcaccccg
gcatggcttgggcaaaaccgcttaagccgcagcctggtgtgtgaatgcgaggccgtcacc
gctggcgaagtgcaatatgccgttgaaaacctggcggtaaataacttactcgatctccga
cgccggacacgcaccggcatgggcacctgccagggcgagctgtgcgcctgtcgcgcagcc
gggcttctgcagcggtttaacgtaaccacctcggcccagtcattgacccagttgagcgag
ttccttaacgagcgctggaagggcgtacagcccgtggcctggggggatgcgttacgcgag
agtgaatttacccgctgggtctatcagggtttatgcggactggaaaaggaacctcatcat
gaagtttga

DBGET integrated database retrieval system