KEGG   Lelliottia amnigena: A8A57_18540
Entry
A8A57_18540       CDS       T04400                                 

Definition
(GenBank) galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
laz  Lelliottia amnigena
Pathway
laz00052  Galactose metabolism
laz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:laz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    A8A57_18540
Enzymes [BR:laz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     A8A57_18540
SSDB
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C 2-Hacid_dh_C ADH_zinc_N_2 TrkA_N UDPG_MGDP_dh_N Shikimate_DH ELFV_dehydrog MTS Methyltransf_25 PrmA
Other DBs
NCBI-ProteinID: ANG94296
UniProt: A0A1A9FFD9
LinkDB
Position
4004287..4005330
AA seq 347 aa
MKSVVIHAEGSVRVEERPLPQIQGTDDVLVRIVCSGLCGSDIPRIFAKGAHYYPITLGHE
FSGYVAACGDSVKDLKPGDAVACVPLLPCFSCPECEKGYYSLCKNYQFVGSRSEGGNAEY
IVVKRANVFRLPEAMAIEDGAFIEPITVGLHAFHLAAGCEGKNVIIVGAGTIGLLAMQCA
LALGANSVSAIDINDDKLALAKRLGATEVFNSLYQSADEILTAMTDRRFDQLVLETAGTP
QTVSLAIDIAGPRAQVALVGTLHNDLNLPAATFGKILRKELKLLGSWMNYSAPWPGEEWE
TATRLLSAKKLQLAPLIAHSGDSESFAQAVQALNGAPMQGKIMLRFA
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaatcagtggttattcacgctgagggcagcgtgcgcgttgaagaacgccccctacct
caaatacagggcacagatgatgtattggtacgcattgtgtgctcaggtttatgtggctcg
gacatcccgcgtattttcgccaaaggggcacattactaccccataacactgggccatgaa
tttagcggatatgtcgcggcttgcggcgattccgtaaaggatcttaaaccaggcgatgcg
gtggcctgcgtcccattactgccctgtttttcctgtccggaatgtgagaagggttattac
tcgttatgtaaaaattatcagttcgtcggctcgcgtagtgaaggcggcaacgcggagtat
atcgtcgtgaaacgcgcgaatgtattccgccttcctgaagcgatggcgattgaagatggc
gcctttattgagccaattaccgtagggctgcacgcgtttcatcttgccgcgggctgcgaa
ggaaaaaatgtcattatcgttggggcgggtactatcggtcttctggcaatgcagtgtgca
ctggcgcttggcgcaaatagcgtgagcgccattgatatcaatgacgataagctcgctctg
gcgaaacgactgggggctactgaggtatttaacagtctctatcaaagcgctgacgagatc
cttaccgcgatgactgaccgcagatttgatcagttggtgctggagacagctggaacgcca
caaaccgtttcacttgccattgatattgccggtccacgcgcgcaggttgccctggtagga
acgctgcacaatgacctgaacttacccgccgcaacatttggcaaaattctgcgtaaggag
ctaaagcttttgggaagctggatgaactattcagccccgtggccaggagaagagtgggaa
acagctacccgtctgctttcggcgaaaaaactacagcttgcgcccctgattgcacatagt
ggagatagcgagagttttgctcaagccgtgcaggcgctgaatggtgctccgatgcaaggc
aaaattatgttgcgcttcgcataa

DBGET integrated database retrieval system