KEGG   Lelliottia amnigena: A8A57_20140Help
Entry
A8A57_20140       CDS       T04400                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
laz  Lelliottia amnigena
Pathway
laz00250  Alanine, aspartate and glutamate metabolism
laz00410  beta-Alanine metabolism
laz00640  Propanoate metabolism
laz00650  Butanoate metabolism
laz01100  Metabolic pathways
laz01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:laz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    A8A57_20140
   00650 Butanoate metabolism
    A8A57_20140
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A8A57_20140
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A8A57_20140
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:laz01007]
    A8A57_20140
Enzymes [BR:laz01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     A8A57_20140
Amino acid related enzymes [BR:laz01007]
 Aminotransferase (transaminase)
  Class III
   A8A57_20140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: ANG94595
UniProt: A0A1A9FH93
LinkDB All DBs
Position
complement(4314703..4315968)
Genome map
AA seq 421 aa AA seqDB search
MKNNELNERRLQATPRGIGVMCPFYADKAENATLWDVEGNEVIDFAAGIAVLNTGHRHPK
VIAAIEKQLHAFTHTSYQIVPYEGYIALAERINARVPIDGPAKTAFFSTGAEAVENAVKI
ARAYTRRPGLITFGGAFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHAQFPNTLYGVSSQ
DALKSLDRLFKADIAPDQVAAIIIEPVQGEGGFNVAPADFMQGLRALCDTHGILLIADEV
QTGFARTGKLFSMEHHCVKPDLITMAKSLAGGMPLSAVSGRAEVMDAPASGGLGGTYAGN
PLAIAAALAVLEVIDEEDLCTRAAHLGHHLVEVLNKATSACPFIADIRAQGSMVAVEFND
PQTGMPSPEFTRQVQERALQEGLLLLSCGIHGNVIRFLYPLTVPEAQFRKALDIIFAALT
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaataacgaactgaatgaacggcgtttacaggccacgccgcggggcattggcgtg
atgtgccctttttacgctgacaaagcggagaacgccacgctgtgggacgtcgaaggcaat
gaagttatcgatttcgccgccggcatcgcggtgctgaataccggccatcgccatccaaaa
gtcattgccgccattgagaaacaactccacgcctttacccatacgtcttatcagattgtc
ccctatgagggctatatcgcgcttgcggagcgaatcaatgcccgcgtcccgattgacggc
ccggcgaagacggcgttcttttcaaccggtgctgaagcggtcgaaaacgcggttaaaatt
gcccgggcttatacccgacgtcctggcctcatcaccttcggcggcgccttccatgggcgc
acctttatgacgatggcgctgaccggtaaagtcgcgccttataaaatcggatttggtcct
ttccccggttcggtttatcacgctcaatttcccaacacgctgtacggcgtcagctcccag
gatgcgctgaaaagtctggatcgcctgttcaaagcggatatcgccccggatcaggtggcg
gccattattattgaaccggttcagggggaaggcggctttaacgtcgcaccggcagacttt
atgcagggattgcgggcgctatgcgacacccacggtattctgctgattgccgatgaagtg
cagacgggatttgcccgtaccggcaagttattctcgatggaacatcactgcgtgaagcca
gatctgatcaccatggcgaaaagcctggcgggcggcatgccgctctccgccgtttcgggt
cgcgctgaggtgatggatgcccctgcgtccggcggtctgggcggcacctacgccgggaac
ccattggcgattgcggcagcgctggcggtgctggaggtgatagacgaagaagatctgtgc
acgcgcgcggcgcatctgggtcatcaccttgtggaagtgctgaataaagcgacatcagcg
tgtccgttcatcgccgatatacgcgctcagggctcgatggtggcagtggagtttaacgat
ccgcaaaccggcatgccgtcaccggaatttacccgccaggtgcaggagcgcgcgctgcag
gaggggctgctcctgttgagctgcggcatccatggcaacgtcatccgcttcctttatccc
ctcacggtgcctgaagcgcagttccgcaaagcgctggatattatcttcgctgcgctgacg
cgttaa

DBGET integrated database retrieval system