KEGG   Lelliottia amnigena: A8A57_20305Help
Entry
A8A57_20305       CDS       T04400                                 

Definition
(GenBank) beta-ketoacyl-[acyl-carrier-protein] synthase II
  KO
K00647  3-oxoacyl-[acyl-carrier-protein] synthase I [EC:2.3.1.41]
Organism
laz  Lelliottia amnigena
Pathway
laz00061  Fatty acid biosynthesis
laz00780  Biotin metabolism
laz01100  Metabolic pathways
laz01212  Fatty acid metabolism
Module
laz_M00083  Fatty acid biosynthesis, elongation
laz_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:laz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    A8A57_20305
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    A8A57_20305
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:laz01004]
    A8A57_20305
Enzymes [BR:laz01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.41  beta-ketoacyl-[acyl-carrier-protein] synthase I
     A8A57_20305
Lipid biosynthesis proteins [BR:laz01004]
 Fatty acid synthase
  Component type
   A8A57_20305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ketoacyl-synt_C ketoacyl-synt Thiolase_N ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ANG94627
UniProt: A0A1A9FHM0
LinkDB All DBs
Position
4344124..4345293
Genome map
AA seq 389 aa AA seqDB search
MIYISAVGMVNALGNSADEIARNLTAGIAPGMRSRSGWLQGCPDAVLGGVEGELPLIPDE
MAAHRTRNNQLLLAALAQIQSDVDAAIARVGRDRVAVVLGTSTSGLDEGDTHARLSLKGE
ASPAWQYPQQELGDPSRFLAKWLALEGPAYTISTACSSSARAIVSGQRLIDAGLVDIALV
GGADTLSRMPVNGFNSLEALSPTLCEPFGRDRRGITIGEGAALMILTREPQPVALLGTGE
SSDAWHISAPHPQGEGAIRAIHQALREARLQPADVGYINLHGTATPLNDQIESQVIHDLF
GEQVPCSSTKHLTGHTLGAAGITEAALSWLILSRNLPLPPQDFGRYAPDATLPPCGILSQ
PERLEKPVILSNSFAFGGNNASILLGRVS
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgatttacatttctgcggttggcatggtcaacgcactgggcaattcggctgacgaaata
gcccgtaacctcacggcaggcattgcgccgggtatgcgcagccgcagcggctggctgcag
ggctgcccggatgcggtgctgggcggcgttgagggcgaattgcccctaatccccgacgag
atggcggcgcaccggacccgcaacaaccagctgctgctggccgcgctggctcagattcag
tctgacgtcgatgccgccattgcccgcgtgggccgcgatcgggtggcggttgtgctgggc
accagcacctccggcctggatgagggcgatacgcacgccaggttatccctgaagggcgaa
gcaagcccggcatggcagtatcctcagcaggagctgggcgatccgtcgcgctttctggcg
aaatggctggcgctggaaggcccggcgtacactatttcgaccgcctgctcatccagcgcc
cgggcgatcgtcagcggacaacggctgattgacgcggggctggtcgatattgcgcttgtc
ggcggggcggataccctcagccgtatgccggttaacggatttaacagccttgaagcgctg
tcgccgacgctctgtgaacctttcgggcgtgaccgtcgcggtatcaccattggtgaaggc
gcagcgttaatgatcctcacccgtgagccgcagcccgtcgcgctcctgggcacgggagaa
tccagcgatgcctggcatatttcagcgccccatccgcagggtgaaggggcgattcgcgcc
attcatcaggcactgcgggaagcgcgcctgcagcctgccgacgtggggtatatcaacctt
cacggcacggccacgccgctgaacgatcagatagagtctcaggtgattcacgatctcttt
ggcgagcaggtaccctgcagttcaaccaaacatttaaccggccacacgctgggtgcggca
ggcatcaccgaagcggcgctgagctggcttatcctgtcgcgcaacctgccgttgccgccg
caggattttggccgttacgcgcctgacgccacgctgccgccttgcggaattttgtctcag
cctgaacggctggaaaaaccggtgattttgtctaactcgttcgcgtttggcggcaataac
gccagcattctgctggggagagtgtcatga

DBGET integrated database retrieval system