KEGG   Leptotrichia buccalis: Lebu_0543Help
Entry
Lebu_0543         CDS       T00975                                 

Definition
(GenBank) Dihydrolipoyllysine-residue succinyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lba  Leptotrichia buccalis
Pathway
lba00010  Glycolysis / Gluconeogenesis
lba00020  Citrate cycle (TCA cycle)
lba00620  Pyruvate metabolism
lba01100  Metabolic pathways
lba01110  Biosynthesis of secondary metabolites
lba01120  Microbial metabolism in diverse environments
lba01130  Biosynthesis of antibiotics
lba01200  Carbon metabolism
Module
lba_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lba00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Lebu_0543
   00020 Citrate cycle (TCA cycle)
    Lebu_0543
   00620 Pyruvate metabolism
    Lebu_0543
Enzymes [BR:lba01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Lebu_0543
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding AATase CAT
Motif
Other DBs
NCBI-ProteinID: ACV38454
UniProt: C7N8H3
LinkDB All DBs
Position
584251..585285
Genome map
AA seq 344 aa AA seqDB search
MENNELRATPAARKLAQQMGLDLFHVKGSGANGRIHKEDVETFKFEKQIRISPLARKIAL
DHNIELENVVGTGHNGKIMRDDILKLIAKPQETEDLARHEKAVVAEEKAVAQQDIEIVPM
TAMRKVISKRMTESYLTAPTFALNYEIDMTEAIALRKKILDTILESTGKKITITDIISFA
VIKTLLKHKFVNSSLSEDGTQIILHNYVNLAIAVGFDGGLLVPVVKGADKMTLSELVVES
KKIVKKALDMKLTPDEQTGSTFTISNLGMFGVQSFNPIINQPNSAILGVSSTVEKPVVVN
GEITVRPMMTLTLTIDHRVVDGLAGAKFMQDLKNALENPIALLI
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataatgagttaagagcgactcctgcagcacgtaaattagcgcagcagatggga
cttgatctgtttcatgtaaaaggcagtggagctaatggacgtattcataaggaagatgtg
gaaacatttaaatttgaaaaacaaataagaatatcgccacttgctagaaaaatagcatta
gatcataacattgaacttgaaaatgttgttggaacagggcataatgggaaaataatgcgg
gatgatattttgaaattgattgctaagccacaggaaacagaagacttggcaagacatgaa
aaggctgttgttgcagaagaaaaagcagtcgcacagcaagatatagaaatcgtgccgatg
acggcaatgagaaaagttatttcaaaacgtatgacggaaagttacctgactgcacctaca
tttgcacttaattatgaaattgacatgacagaagctattgcattaagaaagaaaatactt
gatacaattttggaaagtacaggaaagaaaattacaataacagatattatttcgtttgca
gtaatcaaaactttattgaagcacaaatttgtaaattcaagtctgtcagaagatgggaca
caaattattctgcataattatgtaaacttggcgattgcagtaggatttgatggtggactt
cttgtgcctgttgtaaaaggcgctgataaaatgacacttagcgagctagttgttgaatct
aagaaaatagtgaaaaaagcgctagatatgaagctgacacctgatgagcaaactggaagc
acgtttacaatcagtaatcttggaatgtttggagtgcaaagctttaatccaataataaat
cagccaaattcagcaattttaggagtttcttccacagttgaaaagccagttgttgtaaat
ggcgaaattacagttcgtccaatgatgactttgacacttacaattgatcacagagtggta
gatggacttgcgggagctaaatttatgcaagacttgaaaaatgctttggaaaatccaatc
gctttgttaatttaa

DBGET integrated database retrieval system