KEGG   Laccaria bicolor: LACBIDRAFT_187450Help
Entry
LACBIDRAFT_187450 CDS       T01044                                 

Definition
(RefSeq) hypothetical protein
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
lbc  Laccaria bicolor
Pathway
lbc03030  DNA replication
lbc03410  Base excision repair
lbc03420  Nucleotide excision repair
lbc03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:lbc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    LACBIDRAFT_187450
   03410 Base excision repair
    LACBIDRAFT_187450
   03420 Nucleotide excision repair
    LACBIDRAFT_187450
   03430 Mismatch repair
    LACBIDRAFT_187450
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:lbc03032]
    LACBIDRAFT_187450
   03400 DNA repair and recombination proteins [BR:lbc03400]
    LACBIDRAFT_187450
Enzymes [BR:lbc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     LACBIDRAFT_187450
    6.5.1.6  DNA ligase (ATP or NAD+)
     LACBIDRAFT_187450
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     LACBIDRAFT_187450
DNA replication proteins [BR:lbc03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    LACBIDRAFT_187450
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     LACBIDRAFT_187450
DNA repair and recombination proteins [BR:lbc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     LACBIDRAFT_187450
   NER (nucleotide excision repair)
    Other NER factors
     LACBIDRAFT_187450
   MMR (mismatch exicision repair)
    Other MMR factors
     LACBIDRAFT_187450
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 6068938
NCBI-ProteinID: XP_001873189
JGI: 187450
UniProt: B0CPS5
LinkDB All DBs
AA seq 816 aa AA seqDB search
MGRQQTLAKFFDMPKSVKTPPPQQASLKEMWGKRPIVTKTEEEDEKQDAMDIEPGNNSKA
GSSKRTGALTRPGRSPKLKKRKIVQSNDEQEEQPKRSTTAVVVESGKPTSDDPATFSSQS
LKRKQKESVDAVEDMDAAASAGEGEEEVENDDSDMEVDDGVVSVSAQAALRRKGEVDVKG
GWKVGEPVLYAALTKAFSLIEATTKRLEKTAILTSFLLLVIQRSAKADHNSLLQAVYLCI
NRLSPDYVGVELGIGESLLIKAIAESTGRSLSLIKADLKREGDLGLVAMNSKNSQKTLFK
PKPLTLPFVFSNLRDIALTTGNSSQAKKVSVITKLLAACQDFEAKYIVRSLEGKLRIGNA
ERSVLVALAQAVVLAEKEKVGKKWSQEKLTARLEEGANIIKAVYSELPSYDKVIPALLEV
GIDGLRDKCKLTPGVPLKPMLAKPTKAIGEVLDRFENKRFTCEYKYDGERAQVHKLEDGT
VDVFSRNSEDMSKKYPDLVDQLPRCIKESTKSFVLDAEAVAIDRLTGKLMPFQELSRRKR
KDVKVEDIQVQVCLFAFDLLYLNGEPLLQRPLYERRELLRQYFTPVPGEFDFAKSSDSET
TEEIQTFLEESVKDGCEGLMVKMLDSDASYYEPSRRSVNWLKLKKDYLAGVGDSLDLVVV
GGYYGKGKRTNVYGAFLLACYDSESEEYQTICKIGTGFSEENLQAHYDALKPLETTKVRG
DIKVGGAKPDIWFEPKIVWEVLTADLSLSPIYTAAQGLVEDRGISLRFPRFIRVRDDKGP
DDATGPEQIAEMYERQALAQSNGKKKKGGDADDGFW
NT seq 2451 nt NT seq  +upstreamnt  +downstreamnt
atgggccgccagcaaaccctagcaaagttcttcgatatgcccaagtctgtcaaaacccct
cctccccaacaagcaagtctaaaggagatgtggggtaagaggccgattgtcacaaagact
gaggaagaggacgagaagcaggacgccatggacattgaaccaggaaacaacagcaaagcg
gggagctctaaacgtacgggtgccctcacaagaccaggcaggtcgcccaaattaaagaaa
cgcaagattgttcaatctaatgatgagcaggaggagcaaccgaagcgctcaactacagct
gttgtggttgaatccggcaaaccaacatcggatgatccagcgacgttctcatcccagtct
ttgaagaggaaacagaaggagagcgtggacgcagtggaagacatggatgccgcggcaagt
gcgggagagggcgaggaggaggttgagaatgatgacagcgatatggaagtcgatgatggc
gtcgtgtcggtcagtgctcaggccgctttgcggaggaaaggagaagtcgacgtcaaaggt
ggttggaaagtgggggaaccggtgctatatgcagcactaaccaaagccttctcactcatt
gaggccactacgaagcggctagaaaaaaccgccatattgacatctttcctcctcctcgta
atacagagaagcgcaaaggctgaccacaactctcttctacaagcggtctatctttgtatc
aacagattgagtccagattatgttggtgttgagctgggtatcggggaaagcctcctcatc
aaagctatcgcagagtcgacgggccgtagcctttcccttattaaagcagacctgaagcga
gagggtgatctgggactagtggccatgaactccaaaaacagccaaaagacgctattcaaa
cccaaaccattgactttgccatttgtgttttcaaatctccgagatatcgcgctaactact
ggcaattcgtcgcaagcaaagaaggtgtccgtcatcaccaagcttttggctgcatgtcaa
gactttgaagcaaaatacattgttcgaagcttggagggcaagctgcgcataggcaatgct
gagagatcggtgctcgtagccctagctcaagctgtggtcctggcagagaaagaaaaagtt
gggaagaagtggagtcaagaaaaactcacagctcgactcgaagaaggcgccaacataatc
aaagctgtttacagcgagcttccatcctacgacaaagtcatcccagctttgctcgaagtt
ggaatcgatggtttacgggataaatgtaagcttactcctggtgtacccctgaagcccatg
ctcgccaaacccacaaaagcgattggagaggtgctcgatcgctttgaaaataaacgattc
acctgcgaatataaatatgatggtgaacgagcgcaggtgcataaactggaagacgggact
gttgatgtctttagcagaaattcagaagatatgagcaaaaagtatccggaccttgttgat
caactcccaaggtgtatcaaagagtcaacgaagtccttcgtgttggacgcagaagccgtt
gctatcgatcgcttaacagggaaattgatgccattccaagaactaagccggcgtaagcgt
aaagatgtcaaggttgaggatattcaagttcaagtctgtctctttgctttcgacctcctt
tacctcaacggcgagccgttactgcaaagaccactgtacgagcgacgagaactgctaagg
caatatttcacccccgtaccgggggaatttgattttgcgaagtcttcggacagcgaaacc
actgaggaaattcagacattcttggaagaaagtgtcaaggatggctgcgaagggttgatg
gtgaagatgctggacagcgacgccagctattacgaacccagtcgaagaagtgtcaactgg
ctgaagttgaaaaaggattatctcgcaggagtcggagactcgctcgatctggtggtggtc
gggggctactacgggaaagggaaaaggaccaacgtctacggcgcgttccttcttgcatgc
tatgacagtgagtcggaagaataccaaacgatttgcaaaatcggcaccggctttagtgaa
gaaaaccttcaagcacattacgatgcactcaaaccattggaaacgacgaaagttcggggt
gacataaaagtcggcggagcaaagccggatatttggtttgagcccaaaatcgtttgggag
gttctgacggctgatctcagcctgagtcccatttacactgctgctcaaggactggtcgag
gatcggggtatttcactgcgattcccgcgttttattcgggtacgcgacgacaaaggtccc
gacgacgcgactggacctgagcagatcgcggaaatgtatgagcggcaagcactagctcaa
agtaacggtaagaagaagaaaggtggcgacgctgacgatggattctggtga

DBGET integrated database retrieval system