KEGG   Laccaria bicolor: LACBIDRAFT_188373Help
Entry
LACBIDRAFT_188373 CDS       T01044                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
lbc  Laccaria bicolor
Pathway
lbc00020  Citrate cycle (TCA cycle)
lbc00190  Oxidative phosphorylation
lbc01100  Metabolic pathways
lbc01110  Biosynthesis of secondary metabolites
lbc01130  Biosynthesis of antibiotics
lbc01200  Carbon metabolism
Module
lbc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lbc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
lbc_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:lbc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LACBIDRAFT_188373
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    LACBIDRAFT_188373
Enzymes [BR:lbc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     LACBIDRAFT_188373
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 HI0933_like DAO Lycopene_cycl
Motif
Other DBs
NCBI-GeneID: 6071949
NCBI-ProteinID: XP_001875882
JGI: 188373
UniProt: B0CVS9
LinkDB All DBs
AA seq 639 aa AA seqDB search
MFRKALPRALPRSSRAFHSSPSVAKLVATNPAKAEEVKSWSSGKYPLIEHEFDAVVVGAG
GAGLRAAFGLAEAGFKTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGS
DWLGDQDAIHYMCREAPHTVIELEHYGVPFSRTPEGKIYQRAFGGQSLKYGKGGQAYRCA
AAADRTGHALLHTLYGQSLRHNTNFFIEYFALDLIMQDGECVGVIALNMEDGTLHRFRSH
KTVLATGGYGRAYFSCTSAHTCSGDGNAMVVRAGLPLQDLEFVQFHPTGIYGAGCLITEG
SRGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTIEIREGRGVGPEKDHLYLQLSH
LPAEVLHERLPGISETAAIFSGVDVTKEPIPVLPTVHYNMGGIPTKYTGEVLTVDKDGND
KVVPGLYAAGEAACVSVHGANRLGANSLLDIVVFGRAVAHHIRDTLSPGKSHKGIPEEAG
IESIEFLDKIRRSDGPEPTAKIRLDMQKAMQTDAAVFRTQKTLDEGVEKVRSIYRNFDNV
GIKDRSMIWNSDLVETLELRNILQCAIQTITSAAARKESRGAHAREDFPDRDDENWMKHT
LSFQHDVNSPDVELKYRKVIDTTLDEAECKPVPPFKRVY
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgtttaggaaagctcttccgagagctttgcctcgctcttcacgagcctttcactcgtca
ccttcagtcgcgaagctcgtcgccactaatcccgccaaggctgaggaagtcaagtcatgg
tcgtcgggaaagtacccgctaattgaacacgagttcgatgccgttgtcgtaggtgctggt
ggtgcggggttacgtgcagcctttggtttggctgaagctggcttcaaaactgcttgtatc
accaagttgttccccaccagaagtcacactgttgctgctcagggtggtatcaatgctgct
cttgggaacatgactgaagatgattggcggtggcatatgtatgatactgtcaaaggatcc
gactggcttggtgaccaagacgcaatccactacatgtgtagagaagctccccataccgtc
attgagcttgaacactacggcgtgcctttctcgcgtacaccagagggaaaaatctaccaa
cgcgcctttggtgggcaatctttgaaatacggaaagggaggccaggcctaccgttgcgca
gccgccgctgaccgtactgggcatgccctcctgcacacgctctacggccaatctctgcgt
cacaacaccaacttcttcattgagtactttgccctcgacttgattatgcaagacggcgag
tgcgtgggtgtcattgctctgaacatggaagacggcacactccatcgcttccgctcgcac
aagaccgtcttggcgacgggtggttacgggcgagcgtattttagctgcacgagcgcccac
acttgctctggagatggcaatgccatggtcgttcgtgccggacttccccttcaggatttg
gaattcgtccagttccatcccacgggtatttatggtgccgggtgccttatcacagagggt
tctcgaggtgaaggagggtatctcttgaactctgagggtgaacggttcatggagcgttat
gcgcctaccgcgaaagatctcgcttcgcgtgatgtcgtttcccgttccatgacaattgaa
attcgcgaaggtcgtggtgttggtcctgagaaggatcacctctacctccaattgagccac
cttcccgctgaagtcctccacgagcggctgcccggtatctctgaaactgccgccatcttc
tctggtgtcgacgtcactaaggagcctatcccggttctgcccaccgtgcactacaacatg
ggtggtatccctactaaatacaccggcgaggtccttaccgttgacaaggatggcaatgac
aaggttgtccctggtttgtacgctgccggagaagccgcttgtgtgtccgtgcacggtgcc
aaccgtcttggtgcaaattcgctgctcgatatcgtcgtgttcggccgtgctgtcgcccac
catatccgagacacactgtcacctggcaagtcgcacaaggggattcctgaggaggctggc
atcgagagcattgagttcctggacaagattaggcgttctgacggcccagagccaactgcc
aagattcgtcttgacatgcaaaaagccatgcaaaccgatgctgctgtcttcagaacccaa
aaaactctcgacgaaggtgtcgagaaggttcgctccatctatagaaactttgataatgtc
ggtatcaaggacaggagcatgatttggaactcggatcttgtggagacgcttgaactgcgc
aatatcctccagtgcgccatccagacaatcacctctgctgctgcccgtaaagagtctcgt
ggtgctcatgctcgtgaagatttcccagaccgtgacgacgagaactggatgaaacatacc
ctttcattccaacacgatgtcaactcccccgacgtcgagctgaagtaccgcaaagttatt
gacacgacgctcgatgaggccgagtgcaagcctgtgcctccattcaaacgtgtgtattag

DBGET integrated database retrieval system