KEGG   Laccaria bicolor: LACBIDRAFT_231002Help
Entry
LACBIDRAFT_231002 CDS       T01044                                 

Definition
(RefSeq) hypothetical protein
Organism
lbc  Laccaria bicolor
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_5 Glutaredoxin Inhibitor_I10
Motif
Other DBs
NCBI-GeneID: 6072254
NCBI-ProteinID: XP_001876482
JGI: 231002
UniProt: B0CZV3
LinkDB All DBs
AA seq 277 aa AA seqDB search
MSTANDNDRGRPYHTQCTGPALATVSQHKGEADITLFGGCFCPFVQRVWVAFEYMGIPYK
VYEVDPYKKPQDLLEVSPKGLVPALRFNRYNPPRALNESTVIMEFLEDLASSTTKRTLLP
PLSNPYARALVRLQADHISRTIVPAFYRYLQAQESEEQIAKEKDFHAAIDGAGERVALKK
GLGLWIESEGGQDLGWSDVMVAPWILRAKIVLRHYRGFDLAKGERFNAWVNRLLEHPAFK
ATCSAEQLYLDSYERYAFNRPNTSQVADAINQGKALP
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgtctaccgccaatgacaacgacagaggtcgaccctatcatacccaatgtacaggtcct
gccctcgccacagtgtcgcagcacaagggtgaagcagatataacgcttttcggcggctgc
ttttgtccctttgtccagcgtgtctgggttgctttcgaatacatgggcattccatacaag
gtctacgaagtggatccctataagaaaccccaagacctattggaagtatctccgaaaggg
ctggtacccgcgctccgatttaacagatacaacccgccaagagccttgaatgaaagtacc
gttatcatggagtttttggaggatctcgcatcatcaacaaccaaacggactctgctgccc
cctctatccaatccctacgcacgggcgctggtgcgacttcaggctgaccacataagtcgt
actattgtacccgccttttacagatatcttcaagcgcaagagtctgaggaacaaatcgcc
aaagagaaggatttccatgctgctattgacggagctggtgaacgggtcgcattgaaaaag
ggtttaggactttggattgaatcggagggaggacaggatttggggtggtccgatgtcatg
gttgcaccatggatcttaagagcgaagatagtgttgagacactaccgtgggttcgacctt
gcgaagggggaaagattcaacgcttgggtaaacaggctgttggaacatcctgcgttcaag
gcaacttgcagtgctgaacaactttatttggacagctacgaaaggtatgcgttcaataga
ccaaacacaagccaggtcgccgacgcaattaatcaaggaaaagcactgccgtaa

DBGET integrated database retrieval system