KEGG   Laccaria bicolor: LACBIDRAFT_295043
Entry
LACBIDRAFT_295043 CDS       T01044                                 

Definition
(RefSeq) delta 9-fatty acid desaturase protein
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
lbc  Laccaria bicolor
Pathway
lbc01040  Biosynthesis of unsaturated fatty acids
lbc01100  Metabolic pathways
lbc01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:lbc00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    LACBIDRAFT_295043
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lbc01004]
    LACBIDRAFT_295043
Enzymes [BR:lbc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     LACBIDRAFT_295043
Lipid biosynthesis proteins [BR:lbc01004]
 Desaturase
  First
   LACBIDRAFT_295043
SSDB
Motif
Pfam: FA_desaturase Cyt-b5
Other DBs
NCBI-GeneID: 6080347
NCBI-ProteinID: XP_001884841
JGI: 295043
UniProt: B0DLL9
LinkDB
AA seq 465 aa
MPSSTRQQSKLVDESVPADLNIPDNYVQHTLKTIKPLPPVTWSNWTTELDYLNVAILTLT
PVVGLVGAYFTELRWETCLFAIFYYYVTGLGITAGYHRLWAHRAYNASLPLQYFLAIVGA
GAVEGSIKWWSRGHRAHHRYTDTDLDPYNAHRGFFYSHVGWMMIKPRRKPGVADVSDLAK
NPVIRWQHKHYIALIFLMGFILPTVVPWLLWGDAQGGYIYAGVLRLCFVHHSTFCVNSLA
HWLGETPFDDKHTPRDHLITALATIGEGYHNFHHQFPMDYRNAIKWYQYDPTKWFIWACQ
KLGLASHLKVFPDNEVRKGQLTMELKKLRETQEKLSWPNDSNDLPVISWESFQEQALKRP
LILISGFIHDVGTFVDEHPGGPHLLIKFIGKDATTAFFGGVYDHSNAAHNLLAMKRVGVL
HGGAPHGLEDKMIPPSQRLKIARYTELTSPYNSSTAYSDGEGMLG
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgccgtcctccaccaggcaacagtcgaagctcgtcgacgagtccgttcctgccgacctc
aatattcccgacaactacgtccagcacactctcaaaacaataaaaccccttccacccgtc
acttggagtaactggaccacagagctcgactatctcaacgtcgctatcctcaccctcacc
cccgtcgttggccttgttggtgcctactttacagagctccgttgggaaacctgtcttttc
gctattttctactactacgtgacaggccttggcatcaccgcaggctatcatcgtctgtgg
gctcatcgcgcatacaacgcatcattgcctctgcaatattttttggctatcgttggtgca
ggtgccgttgagggttctatcaagtggtggtcacgaggtcatcgagctcaccaccgttac
accgacaccgaccttgacccttacaatgctcatcgtggctttttttactcccatgtcggt
tggatgatgattaagcccagaaggaagccaggcgtcgcagacgttagcgaccttgcaaag
aatcccgtcattcgctggcaacacaagcattatattgcgctcattttcctcatgggcttc
attcttccaaccgttgttccgtggttattgtggggagatgctcaaggtggatacatatat
gctggtgttctcaggttgtgctttgtccaccactccacattctgcgtcaactcgcttgcg
cattggcttggagagactcctttcgatgacaagcacacacctcgcgaccatctcataacc
gcattggcgacaattggggagggctatcacaatttccaccatcagttccctatggattac
cgaaacgccatcaagtggtaccagtatgaccccaccaagtggttcatctgggcatgtcag
aagcttggcttggcttcccacctcaaggttttccctgacaacgaagtccgaaaaggtcaa
ctaacgatggagttgaagaagcttagggagacgcaggagaagctgtcttggcccaatgat
agcaatgacctgcctgtgatcagttgggaaagcttccaagagcaagctctgaagcgacct
ctcattcttatttccggctttattcacgacgtcggaacatttgttgatgaacatcccggt
ggcccacatttgttgatcaaattcattggcaaggacgctacaacagccttctttggcggt
gtttacgatcactcaaatgctgctcacaacctcctcgcaatgaagcgcgttggtgtcctc
catggaggtgcaccccacggcctggaagataagatgataccacccagtcaacggctgaag
attgcgcggtacaccgagctcacgtctccatacaacagcagcaccgcgtactcggacggg
gaagggatgctcggttga

DBGET integrated database retrieval system