KEGG   Laccaria bicolor: LACBIDRAFT_305524Help
Entry
LACBIDRAFT_305524 CDS       T01044                                 

Definition
(RefSeq) DNA ligase IV
  KO
K10777  DNA ligase 4 [EC:6.5.1.1]
Organism
lbc  Laccaria bicolor
Pathway
lbc03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:lbc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    LACBIDRAFT_305524
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lbc03400]
    LACBIDRAFT_305524
Enzymes [BR:lbc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     LACBIDRAFT_305524
DNA repair and recombination proteins [BR:lbc03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA Ligase 4 complex
     LACBIDRAFT_305524
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N BRCT_2 DNA_ligase_A_C RNA_ligase BRCT PTCB-BRCT LIG3_BRCT
Motif
Other DBs
NCBI-GeneID: 6070492
NCBI-ProteinID: XP_001874645
JGI: 305524
UniProt: B0CUG3
LinkDB All DBs
AA seq 1059 aa AA seqDB search
MMQPTPAPSSAPNSPERKLEPLAESQTYPAPPQNVGSAPFGVLVGLFDKLQVERKQDRRR
KLIETWFNHWREEKGYDLYPVLRLILPQKDRERAVYGLKEKNLAKTYIKLIPLGMRDPDA
IRLLNWKKPTEREKTSGDFPTVLYEVVSKRSSVIEGSLSIDELNDILDELAKNMGKQDIQ
SGILRRIYNRSTAQEQRWIVRIILKDMIISVKETTIFSVFHPDAQDLYNTCSDLKKIAWE
LWDPSFRLNAEDKAVQLFHAFAPMLCKRPTKKIEETVREMSGSEFFIEEKLDGERMQLHK
RGNEYLYFSRKGKDYTYLYGKHVGTGSLTPFIDKAFDPRVDDIILDGEMLVWDPVSERNL
PFGTLKTAALDKSKKEHNPRPCFKVFDLLYLNGQSLLHKSTAFRKKNMRNCLKEITGRIE
YAVDYKGTTAKDIRKRMDEVMGNRGEGLVIKHPLSKYVLNGRNMDWIKVKPEYMDNMGET
VDVLVVAGNYGTGKRGGGVSTLICAVLDDRRANEDDEEPKYSTFVRIGSGLSFADYVWVR
DKPWKVWDPKHPPEFLQTAKRTHEDKGDLYLEPEDSFILKVKAAEITPSDQYHMGFTMRF
PRALSIRDDLSIADCMTATAVFESLRSEKKRKMESDAGVSSKKRKTTAKKATVLPAYKGP
NLKGVRVKTDILDGLKFGELLASCSIYQVLIRLTPVVMADPKSRTGDEERKELMKLIHAN
GGSCAQVANNQPELFIVYEGNTIPYDLKLLIDKNVYDVIKPNWITDSVALGEPAPLRKKY
FFRATDERASTDEYMQEDEDQAFEAPTLKEDPSAKLEEEMVPKVEEQEYDIDPSLADWLK
IDDKNEKLHAEAKEEQDDYSATDDDSDNADVLEPEEVDLDDWLKVESADEPSVIASAATG
SESLSTDCVDVKMGETEAAMEYDQDLIFKHLCFYLDSPENAQRNQMIVKTRYEKDIKQRH
VVVLRVCIEPVTDCAPPSFVDLSKVIADNGGKIVDLDEPKLTHIIIDKRDDSRRLELMKR
TSKRRLIISEYVQACLDEGTLLDEDGAYHFRDDRRGCLT
NT seq 3180 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaaccaactcctgctccatcttccgccccgaattctccagaacggaaacttgaa
cccttagcagagtcacaaacatatcctgcgccccctcagaatgttggaagtgcacctttt
ggagttcttgttggtctctttgacaagcttcaagttgaaaggaaacaggacaggcggagg
aagttaatcgagacgtggttcaatcactggcgtgaggagaaaggatacgatctttatccc
gtcttgcgtttgattctacctcagaaagaccgagaacgtgctgtctatggcttgaaagag
aaaaatcttgcgaaaacctacattaagttgattcctttgggcatgcgagatcctgatgcc
atccgtcttttgaactggaagaaaccaactgaacgagaaaaaacctcaggagattttccg
actgttctgtacgaggtcgttagcaagcggtcctccgttattgagggatctttgtctatt
gacgagttgaatgacatccttgacgaactggccaaaaatatgggcaaacaagacattcag
tcgggtatcttgcgacggatatacaaccgttcgacggcccaagagcaacgctggatcgtt
cgtattatattgaaagatatgatcatatctgtaaaggagaccactattttttcagtgttt
cacccagatgctcaggacctatacaatacttgttccgatctcaaaaagattgcatgggaa
ctttgggatccttccttcaggctcaacgcggaagataaagcagtccagttatttcatgct
ttcgcgccaatgttgtgtaagcgtccaacgaagaagatcgaagaaactgtccgagaaatg
agtggttccgagttctttatagaggagaaactcgacggagagaggatgcaactgcacaag
agaggcaacgaatatttatatttttctcggaaaggaaaggattacacatatctgtatggg
aaacacgttggcacgggaagcttgactccgtttatagacaaggcctttgatcctcgagtg
gacgatataattttagacggtgaaatgctagtttgggatcctgtgtctgagcgtaatcta
ccgttcgggacattgaagacggcagcactcgacaagtctaagaaagagcacaacccgcgc
ccttgtttcaaagtttttgatcttttgtacctgaacggtcaatcccttctccataaatcg
acagcttttcgaaagaagaatatgcgaaactgcctcaaggagatcaccggaagaattgaa
tatgcggtcgactacaaaggcactaccgcgaaagacatccgaaaaagaatggacgaagtg
atgggtaaccgcggtgagggcttggttatcaaacatccgttatccaagtacgttttaaat
ggaaggaatatggattggatcaaggtgaaacccgaatatatggataatatgggagaaact
gttgatgttctcgttgttgccgggaactatggaactggaaagcgtggtggaggcgtttca
acgctcatctgtgctgtcttggatgaccgccgagcaaacgaggatgacgaagagccaaaa
tacagcacctttgttcgtatcggttctgggctgtccttcgccgactacgtttgggtgaga
gataaaccatggaaggtctgggatccaaagcatccccccgaattccttcagactgccaag
cggactcatgaagacaagggagacctctatctagaaccggaggattcatttatactgaaa
gtcaaagctgctgagatcacgccgtcagatcaatatcatatgggctttaccatgcgattc
ccccgtgccttatccatccgagacgacttaagcattgcggattgcatgactgctacagct
gttttcgaaagcctgcggtcggagaagaagcgcaaaatggagagcgacgcgggagtatcc
tccaagaaacgcaaaacaacagcgaaaaaagcaactgtcctcccagcatataagggccca
aatttgaagggagtacgagtaaagacggatatcctggatgggctaaagtttggcgagctc
cttgcttcctgctccatctatcaggtgcttatacgccttactccagtggttatggcggat
cctaaatccagaacgggtgatgaagaaaggaaagaactgatgaaattgattcacgccaac
ggcggatcctgtgcccaagttgccaataatcaaccagaattgttcattgtatatgagggc
aataccattccgtatgacttgaagctgctgatcgacaaaaatgtgtacgatgtgataaag
ccaaattggatcacagattcagtggctctaggcgagcctgctcccttgcgcaaaaaatat
ttctttcgtgcgacggacgagcgggcatcgacggatgagtacatgcaggaggacgaagac
caggccttcgaagcacccacgctcaaagaagacccgagtgcgaagctcgaggaggaaatg
gttccaaaagttgaggaacaagaatatgacattgatccctcgttggcagattggctcaag
attgatgataagaatgaaaagcttcatgcggaggccaaggaggaacaggatgattattcc
gcaactgacgacgattccgacaacgctgacgttttggaaccggaagaggtggatctggat
gactggctcaaagtggaatccgcggatgagccttctgtcatagcttctgcagctacagga
agtgaatcactgtctaccgactgtgtggacgtgaagatgggagaaacggaggccgcaatg
gaatacgaccaagatcttatcttcaagcatctatgcttctacctcgactctccagaaaac
gctcagcgaaaccagatgatcgtgaaaaccagatacgaaaaggatatcaagcaaaggcat
gttgtggtcctccgtgtgtgcattgagccagtgactgattgtgcaccgcccagctttgtc
gacctctcaaaagtgatcgccgataacgggggaaagattgtcgacctcgacgaacccaag
ctgactcatattattatcgacaagagggacgacagtcggcgcttggagctcatgaagcgc
acatcgaaacgacgtctgattatatcggagtacgtgcaagcatgcttggacgaagggaca
cttcttgacgaagatggtgcgtatcatttccgggacgaccgacgagggtgtctaacgtag

DBGET integrated database retrieval system