KEGG   Laccaria bicolor: LACBIDRAFT_315921Help
Entry
LACBIDRAFT_315921 CDS       T01044                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lbc  Laccaria bicolor
Pathway
lbc00250  Alanine, aspartate and glutamate metabolism
lbc00410  beta-Alanine metabolism
lbc00430  Taurine and hypotaurine metabolism
lbc00650  Butanoate metabolism
lbc01100  Metabolic pathways
lbc01110  Biosynthesis of secondary metabolites
Module
lbc_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:lbc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LACBIDRAFT_315921
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LACBIDRAFT_315921
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LACBIDRAFT_315921
   00430 Taurine and hypotaurine metabolism
    LACBIDRAFT_315921
Enzymes [BR:lbc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LACBIDRAFT_315921
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 6073940
NCBI-ProteinID: XP_001878222
JGI: 315921
UniProt: B0D3H6
LinkDB All DBs
AA seq 537 aa AA seqDB search
MALSKHVNADHLIQKSHDKHATHGEFAAEQAQEATYSYGSRYGTNPVPKYRISSKGVSAD
AAYQIIHDELSLDGSTVLNLASFVHTWMPPQADKLVHENITKNLIDTDEYPATQIIHTRC
ISILADVWHAPSSKQAIGTATTGSSEAIQLGGLAMKKIWQAKRKAAGKSIHEPGPNIVMG
ANAQVALEKFARYFDVECRLVPISVQSKYRLDPKEAIKYVDENTIGVFVILGSTYTGHYE
PVKEISDLLDEYEAKTGNSVPIHVDAASGGFIAPFAHPKLLWDFKLPRVVSINTSGHKFG
LSYVGVGWVVWRDKAHLPKDLIFELHYLGSVEYSFSLNFSRPAAPIIAQYFNLLHLGFEG
YREVALDDLKNARLLSRALENTGYYTVLSDVHRSVGAVGGKGIDTHDVEAYEPGLPVVAF
RFSDEFQQKNPEVEQKWIQTLLRAKGWIVPNYELAPDLQQVQILRVVIRENVTEVLLDKL
IADIVEITEELASKASSEHALNVLGQMHGARKKHEHKTSTFDAGEGSEASGTYARSC
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggcgctttccaagcatgtcaatgccgaccacctcattcaaaagtctcatgacaaacac
gcaactcatggcgaatttgctgcagaacaagcacaagaagcaacatattcatatggctct
cgttatggaaccaatcctgttccaaaatatcgtatctcctctaaaggtgtttctgcggac
gccgcctatcagatcattcacgacgaacttagccttgatggatctaccgtcctcaatctg
gcgtccttcgtccatacctggatgcctcctcaagctgacaagcttgttcacgaaaatatc
acgaaaaatttgattgacacggatgaataccccgctacgcagatcatccacacgcgttgc
atctccattcttgcagacgtgtggcacgcgccatcatcaaagcaggcaatcggaactgcg
acaacaggctcctcggaagccatccaactcggaggccttgccatgaaaaagatttggcag
gcaaaacgcaaagctgctggaaagagtattcacgagcctgggcctaatattgtcatgggt
gcaaacgctcaggttgcattagaaaaatttgctcgatatttcgacgttgagtgcaggctg
gtccccatatctgtacaaagtaaatacaggttggaccccaaagaagcgatcaagtatgtg
gatgagaataccattggtgttttcgtcatccttgggagcacttacacagggcactacgag
ccagtcaaggagatttcggatctcttagacgaatatgaagccaaaacaggaaattctgtg
cccattcacgtcgacgccgcgtctggcggatttattgccccctttgcccacccaaaacta
ttgtgggacttcaaacttccccgcgtcgtatcaatcaacacctcgggtcacaagtttggc
ctgagttacgtgggcgtcgggtgggttgtatggcgagacaaggctcacctccctaaggat
ttaatctttgagctccattatctgggttctgttgaatattcattttccctcaatttttct
cgacctgcagcacctatcattgctcaatacttcaacctcctgcatcttggtttcgagggc
taccgcgaggttgcccttgatgatctgaagaacgcgaggcttctgagccgtgctttggaa
aacactggctactatacagtgttgagcgatgtccatcgttcggtcggggccgttggtggc
aaaggtatcgacacacatgatgttgaggcctacgagcccggccttcctgttgtcgccttc
cgcttctctgacgagtttcagcagaaaaatcctgaagttgaacaaaaatggattcaaact
ctcttgagggctaaaggatggatcgtccccaattacgaattggctccagatttgcagcag
gtccaaattcttcgtgttgtaatccgcgaaaacgtaaccgaggtgctacttgataaactt
atcgcggatatcgttgagataacggaggagctcgcttcaaaagcttcctccgaacacgcc
ttgaatgtgttggggcagatgcatggtgccagaaagaaacatgaacataagacaagtacc
tttgatgcaggcgagggcagcgaagcttctggaacatacgctcgttcttgctaa

DBGET integrated database retrieval system