KEGG   Laccaria bicolor: LACBIDRAFT_317084Help
Entry
LACBIDRAFT_317084 CDS       T01044                                 

Definition
(RefSeq) hypothetical protein
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
lbc  Laccaria bicolor
Pathway
lbc00020  Citrate cycle (TCA cycle)
lbc00480  Glutathione metabolism
lbc01100  Metabolic pathways
lbc01110  Biosynthesis of secondary metabolites
lbc01130  Biosynthesis of antibiotics
lbc01200  Carbon metabolism
lbc01210  2-Oxocarboxylic acid metabolism
lbc01230  Biosynthesis of amino acids
lbc04146  Peroxisome
Module
lbc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lbc_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:lbc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LACBIDRAFT_317084
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LACBIDRAFT_317084
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    LACBIDRAFT_317084
Enzymes [BR:lbc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     LACBIDRAFT_317084
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 6074609
NCBI-ProteinID: XP_001878769
JGI: 317084
UniProt: B0D4D3
LinkDB All DBs
AA seq 459 aa AA seqDB search
MTIMQRTCPRSLRALSRPSWTWTPAFPPAATRGFAISLLRQNKMSQKIVVQNPVVELDGD
EMTRIIWKKIREELILPYLELDIKYYDLGLEFRDQTNDQVTVDAANAILKYSVGIKCATI
TPDEARVEEFKLKEMWKSPNGTIRNILGGTVFREPIILSKIPKPIPGWVKPIVIGRHAFG
DQYKCTDFVAPGPGKLQMVYTPADGSAPTALDVYNFKGPGVAMSMYNTDESIIGFAHASF
KMALSKKMPLFMSTKNTILKKYDGRFKDIFQEIYEAEYRTQFEAAGTYYEHRLIDDMVAQ
AVKSSGGFVWACKNYDGDVQSDILAQGFGSLGMMTSELLTPDGRIIESEAAHGTVTRHYR
EWQKGKETSTNPVASIFAWTRGLLHRAKLDGNDALRNFCNDLEGSCVDVIDKDGIMTKDL
ALAIHGKDMKREHWVVTDVYMDAVNAKLQKKLEARVSKA
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcatgcagaggacatgtcctcgcagcctgcgtgcgctaagccgcccctcttgg
acttggacacccgcctttccaccggctgccacgagaggattcgcgatcagccttctacgg
caaaacaagatgtcacaaaagatcgtcgttcagaaccccgtcgtcgaactggatggcgat
gagatgaccaggatcatttggaagaagattcgcgaggagcttatcctcccgtatctcgaa
ctagatatcaagtactacgacctggggttggagtttcgcgaccagacgaacgaccaagtc
accgtcgacgccgccaatgccatccttaaatatagcgtcggcatcaaatgcgcgactatt
actccagacgaagctcgcgtcgaagagttcaagctcaaggagatgtggaagagtcctaac
gggactattcgaaacatccttggtggcacggttttccgtgaaccaattatcttgtccaag
atccccaaacccattcctggatgggtgaagcccatcgtcattggaagacacgctttcggt
gatcagtacaaatgcacggatttcgtcgctcctggacctggcaagctccagatggtttac
acacctgctgatgggtcagcacctaccgccttggatgtgtacaacttcaaaggaccagga
gttgccatgagcatgtacaacaccgatgagtctatcatcggattcgcgcatgcatctttc
aagatggcgttatccaagaaaatgccattgttcatgtcgactaagaacaccattctgaaa
aaatacgatggccgcttcaaagatattttccaggaaatatacgaagctgaataccgaacc
cagttcgaagcggctggcacgtactacgagcacaggctgatcgatgacatggtggcgcag
gcagtcaagtcttccggaggtttcgtgtgggcatgcaagaactatgatggtgatgtccag
agcgacattctcgcacagggctttggaagcttgggtatgatgactagcgagctgctcacc
cctgacggcaggatcatcgagagcgaagccgcccacggaaccgttacccgccattatcgt
gaatggcagaaaggcaaggagacatcgacgaaccccgttgcgtccatcttcgcatggacc
aggggtcttctccaccgcgctaagctcgatggaaatgacgccctccgcaacttctgtaat
gatttagaagggtcatgtgtagatgtcatcgacaaggacggcatcatgaccaaagatctt
gctttggccatacatgggaaggatatgaagagggagcattgggtcgttactgacgtttat
atggatgccgttaacgctaaactccagaaaaagctagaggcgagggtatcgaaggcgtag

DBGET integrated database retrieval system