KEGG   Laccaria bicolor: LACBIDRAFT_395881Help
Entry
LACBIDRAFT_395881 CDS       T01044                                 

Gene name
LbAmy1b
Definition
(RefSeq) GH13 alpha-amylase precursor
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
lbc  Laccaria bicolor
Pathway
lbc00500  Starch and sucrose metabolism
lbc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbc00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LACBIDRAFT_395881 (LbAmy1b)
Enzymes [BR:lbc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     LACBIDRAFT_395881 (LbAmy1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase DUF1966 hDGE_amylase
Motif
Other DBs
NCBI-GeneID: 6084269
NCBI-ProteinID: XP_001888630
JGI: 395881
UniProt: B0DXH7
LinkDB All DBs
AA seq 552 aa AA seqDB search
MFATRFSVFSVLLLAVPTALAASATDWRGRAIYQLLTDRFSLSTNQATSCNTTQALYCNG
TWNGITNHLDYIQGMGFDSIWISPIVANVEQTTAYGQAYHGYWAQDITSLNPHFGTADDL
KALSAALHKRNMYLMVDVVVNHFVSTSSVATSNNANLDFSKLVPFSNSSDFHPYCLITDY
NNQTNVEQCWLGDQYLPLVDLNTENPSIVSTMNNWIQGLVKSYGIDGLRIDTAKHVRKDF
WPAFAKAAGVFTMGEVLIGDVGYAAPYTEVLDSVLDYPNYYTLTSAFGSQTGNFSALINT
VTASQKSYSTPSVVGSFLENHDNPRFQSITQDISLVKNAMTWPFIQDGIPILYQGQEQGF
TGGAMPGNREALWPTGFVTSNKPLVTHVTTLNAARKAAAAANSTFLTTPLKFIIQQDPSL
LAVSKPPLVALLSNLGSNSTKSSTWVAPGVASANEVLVDVLSCAVVKADGSGGVSVPVVN
GLPQVLIPASALAKNGTVCPSVATGSSSGTSGGGKKSGVISIRGGLGFGGMEDGWVVRML
GVVLVGFLAQGW
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgttcgccacgcgtttttctgtcttttctgtgcttctcctcgccgttcctaccgccctc
gccgcaagcgcgaccgactggcgcggaagagctatttaccagcttttaacagacaggttc
tcgctgagtactaaccaagctacgtcttgcaacaccacgcaggcactctattgtaacggg
acatggaacgggatcaccaaccacttggattatattcaaggcatggggttcgactcaatt
tggatctcgcccattgtggcgaacgttgagcagacgacggcgtatgggcaggcgtatcat
gggtactgggctcaggatattacgagtttaaacccccactttgggacggcggacgacctg
aaagcgttgagcgctgcactacacaaacgcaatatgtatttgatggttgacgtcgttgtg
aaccacttcgtgagcacatccagcgtcgccacatccaacaacgcaaacctcgacttttcc
aaactcgtgcccttctcaaattcatctgacttccacccctactgcctcataaccgactac
aacaaccagaccaacgtcgagcagtgctggcttggcgaccaatacctgcccctcgtggac
ttgaacaccgaaaatcctagcatagtttcgactatgaataattggatccaggggctggtg
aagagttatgggattgacgggctgcgcatcgatactgccaaacatgttcgcaaggacttc
tggccggcgttcgcaaaggctgcgggggtgtttacaatgggagaggtgttgattggggat
gtggggtatgccgccccgtatacggaggtattggacagtgtcctcgactacccgaactac
tacaccctcacatccgcattcggctcccaaactgggaacttttccgcactaatcaacacc
gtcacggcttcccagaaatcatactctacgccatccgtagtcggctctttcttggagaat
catgacaatcctaggttccagtctatcactcaagatatctcgctcgttaaaaacgccatg
acatggccctttatacaagacggaattcctatactttatcaaggacaagagcaggggttc
acggggggtgcgatgcctggtaatcgagaagccctgtggcccacaggatttgttacatcc
aacaagccgttagttacgcatgtcactacgctcaacgcggcgcggaaagctgctgctgct
gctaacagcacgttccttaccacgcctctaaaatttataatccaacaagatccctccctt
ctcgcagtctcaaaaccacccctagtagcgctcctcagcaacctgggcagcaactccacc
aaatcatctacctgggtcgccccaggagtggcgagcgcgaacgaagtcctggtagacgtg
ttatcgtgtgctgtcgtcaaggcggatgggagtgggggcgttagcgtgcctgttgttaat
gggttgcctcaggttctgatacccgcttcggcgctggctaagaatggcactgtttgtccc
tctgtggcgacgggatccagcagtggcacctcgggcgggggaaagaagagtggtgtgatt
tcgattcggggtggattggggtttggaggcatggaagatgggtgggtcgtgcgcatgctg
ggtgtggttctggtggggtttttggctcagggttggtag

DBGET integrated database retrieval system