KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Ames): LBF_0288Help
Entry
LBF_0288          CDS       T00712                                 

Gene name
gst-6
Definition
(GenBank) Glutathione transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
lbf  Leptospira biflexa serovar Patoc Patoc 1 (Ames)
Pathway
lbf00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:lbf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LBF_0288 (gst-6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lbf02000]
    LBF_0288 (gst-6)
Enzymes [BR:lbf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LBF_0288 (gst-6)
Transporters [BR:lbf02000]
 Other Transporters
  Pores ion channels [TC:1]
   LBF_0288 (gst-6)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_C_6 GST_N_4 Tom37
Motif
Other DBs
NCBI-ProteinID: ABZ92834
LinkDB All DBs
Position
I:297634..298242
Genome map
AA seq 202 aa AA seqDB search
MKIYGDHQSGNCYKLQLVASFLGITYEWIQLDIKNGDTKTESFLKLNPNGKIPILVLDDG
KVLSESNAILNYLAEGSEFLPKDPYLRAKVLQWQFFEQYSHEPYIAVARFIQHYLGIPEE
RRVEYESKQSGGHKALKVMEIQLEKTPYLIGDFMTIADISLFAYTHVANEGGFDLSQYPK
INQWIERIKNQKQFIPMKSIDM
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttacggtgatcaccaatccggtaattgttacaaactacagttagttgcatct
ttcttaggaatcacatatgaatggattcagttggatattaaaaatggagataccaaaacc
gaatcatttttaaaattaaatccgaatgggaaaataccaatacttgttttagatgatgga
aaggtattatcggaatcaaatgcaatcttaaattatttggcagagggaagtgaattccta
ccgaaggatccttacctaagagcaaaagtattacaatggcagttttttgaacaatatagc
catgaaccgtatatagctgtggctaggttcatccaacattatttaggaattcctgaagag
agaagagttgaatatgaatcaaaacaatctggagggcataaagccctcaaagtgatggaa
attcaattggagaaaactccgtatttaatcggcgattttatgacgatagcagatattagt
ttgtttgcctatacacatgtggcaaacgaaggtggatttgatttgtcgcaatatccaaaa
atcaatcaatggattgaaagaattaaaaatcaaaaacaattcattccaatgaaatcaatt
gatatgtag

DBGET integrated database retrieval system