KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Ames): LBF_1152Help
Entry
LBF_1152          CDS       T00712                                 

Definition
(GenBank) Enoyl-[acyl-carrier-protein] reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
lbf  Leptospira biflexa serovar Patoc Patoc 1 (Ames)
Pathway
lbf00061  Fatty acid biosynthesis
lbf00780  Biotin metabolism
lbf01100  Metabolic pathways
lbf01130  Biosynthesis of antibiotics
lbf01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:lbf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    LBF_1152
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    LBF_1152
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    LBF_1152
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lbf01004]
    LBF_1152
Enzymes [BR:lbf01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     LBF_1152
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     LBF_1152
Lipid biosynthesis proteins [BR:lbf01004]
 Fatty acid synthase
  Component type
   LBF_1152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase
Motif
Other DBs
NCBI-ProteinID: ABZ93676
LinkDB All DBs
Position
I:1251808..1252644
Genome map
AA seq 278 aa AA seqDB search
MNQTLKGRTVIITGITDASSLALIIAKECKDQGAKLICTGLGKTPFHKNLSENSINFLDR
TYSDFQNTVKQELGEDVVTFPLDVTIQESIDSFADFLLEKKETIHSLLHSIAMDKTIRQG
KVKPIMTVSREEFMDAMNVSSFSLLAIVQSLYNRNLLVKGASIVALSYLGAEKVVIHPYK
NIGVAKAALERLVKEMAMELGKEKEIQVNAIRFSPYRASKAGSAIEGLEEAEIHCHTSAP
LGNALAKDLAEEVCYLFRPSNRITGEIRHVDGGYHIRG
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaaactctaaaaggtcgtactgtgatcattactggcatcacggatgcgtcttca
cttgcactcatcattgcaaaagaatgtaaagaccaaggtgccaaactcatttgtacaggt
cttggcaaaacaccgtttcacaaaaatttatctgagaatagtatcaattttttagatcga
acttactcggatttccaaaatacagttaagcaagagttaggtgaagatgtggttactttt
ccattagatgttaccatccaagaaagtatcgattcctttgctgattttctcctagaaaaa
aaggaaaccattcattccttacttcattccattgcgatggataaaaccattcgccaagga
aaagtaaaacccataatgaccgtctcacgagaagaatttatggatgccatgaatgtatct
tccttttcactccttgctatcgtacaaagcctatacaatcgtaacctcttagtgaaagga
gcatcgattgtggcactcagttatttgggtgctgaaaaagtggtaatccacccttataaa
aacattggtgtcgccaaagcggcgttagagagacttgtgaaagaaatggcgatggagtta
gggaaagaaaaggagatccaagtgaatgcgatacgattttctccgtaccgtgcaagtaaa
gcaggttctgccatcgagggattagaggaagcagagattcattgccatacctctgcacca
ctcgggaatgcacttgcaaaagacctggcggaagaagtatgttatttgttccgcccatcc
aatcggatcacaggtgaaattcgtcatgtggatggagggtatcacatcagaggataa

DBGET integrated database retrieval system