KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_0824Help
Entry
Lbuc_0824         CDS       T01477                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
lbh  Lactobacillus buchneri NRRL B-30929
Pathway
lbh00620  Pyruvate metabolism
lbh00680  Methane metabolism
lbh01100  Metabolic pathways
lbh01120  Microbial metabolism in diverse environments
lbh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lbh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Lbuc_0824
  09102 Energy metabolism
   00680 Methane metabolism
    Lbuc_0824
Enzymes [BR:lbh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Lbuc_0824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 PEPcase FTCD_C
Motif
Other DBs
NCBI-ProteinID: AEB73086
UniProt: F4FTN2
LinkDB All DBs
Position
complement(883451..884959)
Genome map
AA seq 502 aa AA seqDB search
MDRKIPNIMGTQHPDNAGVPFFKHNDNAFVSAFREIDEAYQNFSKLDADEYMWDWEGKHA
DASVIDRLYSEHYEYFQKHPLGKDKYLTFRLPNIWEEKGYSLMQAMTTILSAEDFAYDLG
FKERPLFEAILPMTQSADQLISMEDKFASLSHYKSTEFNTGHKDSDTLQMIPLFEGFESQ
LHAPQILKKYLEMYKDHFGRELSYMRVFLAGSDSALSNGFLNSIIGNKLALTGLAEFEQE
SGLPIYPIAGTGSTIFRGGLSPMMIDRYLEEFPGLKTATIQSAFRYDYPLDVVEPAIIKL
RDGLQKSKFEIIDHDDQDILLEIAKKAAAEYHETLDPLINDLQPVFDAFPKRRDRHQHVG
IIGYSRDVDGYKMPRAITFTGALYSVGVPPEFLGTGRILNKLSDKELNTLMKYYPNIKHD
YAHVAKYFSKDALTALQAKNPAWKAVDEDIEAVERLFDIQAGPQTPEQEKHAQLAADLVK
ISDKETKTTLISRQAILRKFLG
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggatagaaaaatccctaatattatgggtactcaacatccagataacgcaggagttcca
ttcttcaagcacaacgataatgcatttgtatccgcatttcgtgaaattgatgaagcttac
caaaacttttccaagctcgatgccgatgagtatatgtgggactgggaaggcaaacacgcc
gatgcatccgtcattgaccgtttgtactccgagcactacgaatatttccaaaagcatccc
cttggcaaagataagtacctcactttccgtctgccaaacatttgggaagaaaagggctac
agtttgatgcaggcaatgaccaccatcttgtccgctgaagactttgcttacgatttggga
ttcaaggaacgaccgttattcgaagctatcttgcccatgacccaatcagccgaccagctg
atttccatggaagacaagttcgccagcctttcccactacaagtcaactgaatttaatacc
gggcacaaagattcagatactctgcaaatgattccattgtttgaaggattcgaatcccag
ttacacgccccacaaatcctgaaaaaataccttgaaatgtacaaagaccactttggccgt
gaattaagctacatgcgggtcttcttggcgggatccgattccgccctttcaaacggtttc
ttgaacagtatcattggtaacaaattagccttgaccggcttggcagaatttgaacaagaa
tctggcttgccgatctatccaattgccggaaccggaagcaccatcttccgtggcggccta
tcaccaatgatgattgaccgttacctcgaagaattccccggtttgaagacggcaacgatt
caatcggcattccgttacgattacccattggatgtggttgaaccagcgatcatcaaactg
cgcgacggccttcaaaagagcaaatttgaaattatcgatcacgacgaccaagacattctc
ttggaaatcgctaaaaaagccgctgcagaatatcacgaaactttggatccactcattaac
gacttacagccggtatttgatgcctttccaaagcgtcgggaccgtcaccaacacgtcgga
atcatcggttactcacgtgacgttgatggctataagatgcctcgtgcgatcacctttacc
ggtgccctgtactcagttggggttccgccagaattccttggaactggccgcatcttgaac
aagctcagtgacaaagaactgaacaccttaatgaaatactatccaaatatcaaacacgat
tatgcccacgttgccaaatacttcagcaaggacgccttgactgctcttcaagccaagaac
cctgcctggaaagcggttgacgaagatattgaagcagttgaacgactattcgatattcag
gccggcccacagacacctgaacaagagaagcatgcccaactagccgctgatctggttaag
atttctgataaagaaaccaagaccaccttaatcagtcgtcaggcaatcttgcgtaagttc
ttaggctaa

DBGET integrated database retrieval system