KEGG   Lactobacillus buchneri NRRL B-30929: Lbuc_1789Help
Entry
Lbuc_1789         CDS       T01477                                 

Definition
(GenBank) drug resistance transporter, EmrB/QacA subfamily
Organism
lbh  Lactobacillus buchneri NRRL B-30929
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_2 MadM
Motif
Other DBs
NCBI-ProteinID: AEB74037
UniProt: F4FT44
LinkDB All DBs
Position
1840331..1841803
Genome map
AA seq 490 aa AA seqDB search
MGNAVDKNGKSYNRGLMIIVILVGTFCTVLNQTILSTAFPTIMKAFDVNTSTVQWLTTGF
MMVNGIMIPVSAWLSTRFNSKWLYISAMTTFFAGTIVCYIAPNFATLLIGRLIQALGVGV
TMPLLQTIMLSIFPPAKRGTAMGLAGIVIGLAPAIGPTLSGWVIDNWTWRDLFGMIIPLM
FLVILASFWLVRSVLDTKKTGIDLLSIVMSTIGFGSLLYGFSSVGEDGWGSTIVISTLIV
GVVFIALFIWRQLTMKTPFLEFRVYRSVPFTVSAILSSVTMMAMVGVEMVIPLYLQIVKG
MSAFHSGLTLLAGALMMGIMSPITGRAVDRFGAKRLSILGMSLLTLGSIPFIFITKSTST
LYIVVFYAIRMFGISMTMMPATTVGMNSLPINLLSHGTAVNNTQRQVAASVGTAVLISIL
TNVTKSNKPAHSMLTSNPLGYRDHMINATLTGYHAAFAISLLFCILALITAFFLKNRGHS
TDYTKNGGED
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
gtgggtaacgcagtagataaaaacgggaagtcatacaaccgtggtttgatgattatcgtt
attctggtcggaacattttgtaccgttctgaatcagacgattctttcaaccgcctttcct
accattatgaaagcattcgacgtcaacacatcgactgttcagtggttgaccactgggttc
atgatggttaacggaattatgattcctgttagtgcttggttaagcacaagattcaattct
aagtggctttatattagtgccatgaccactttctttgccggaacgatcgtttgttacatc
gctcccaactttgcgaccttattaatcggtcgtttgattcaagccctcggtgttggggtt
accatgccattacttcagacaattatgctttccatcttcccacctgccaaacgtgggact
gccatgggacttgccggaatcgttattggcctggcacctgcaattgggccaaccctttcc
ggatgggtcattgataactggacttggcgtgatctgttcggaatgatcattccattgatg
ttcttagttattcttgccagtttctggctcgtcagaagtgtattggataccaagaagacg
ggcatcgacctgctttcaatcgtcatgtctaccatcggatttggaagtttgctttacggc
ttctcatcagttggtgaagatggttggggcagcacaatcgtgatttcaacgttgatcgtc
ggcgttgtcttcatcgccttgttcatttggcgtcaattgactatgaagaccccattcctg
gaatttcgggtctaccgttcagtaccatttaccgtctcagcgattttgagttccgttacc
atgatggccatggtcggagtcgaaatggtcattccactttacctgcagattgttaaaggc
atgtccgcctttcattccggattaacgttgctggccggcgctttaatgatgggaattatg
agcccaattaccggccgggccgttgaccgttttggtgctaaacgcctgtcaatcttagga
atgagcttgttaacattagggtcaattccgtttatcttcattaccaagagcacgtcaact
ttatacattgttgtcttctacgctattcggatgtttggaatttcaatgacaatgatgcct
gctacgactgttggaatgaactcactaccaattaatttgttaagtcacggaactgccgtc
aacaacactcagcgacaggttgccgcttcagttggaacggctgtgttgatcagtatcttg
accaacgtgacgaagagcaacaaaccggctcactcaatgctgacaagtaacccgcttggc
taccgtgatcacatgatcaacgccacgttaaccggttatcacgccgcatttgccatttca
ctgctcttctgtatcttagctttgatcactgccttcttcttgaagaaccgtggtcactca
actgattacactaaaaatggaggtgaagactaa

DBGET integrated database retrieval system