KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I0297Help
Entry
LEPBI_I0297       CDS       T00693                                 

Gene name
gstA
Definition
(GenBank) Glutathione transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
lbi00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:lbi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LEPBI_I0297 (gstA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lbi02000]
    LEPBI_I0297 (gstA)
Enzymes [BR:lbi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LEPBI_I0297 (gstA)
Transporters [BR:lbi02000]
 Other Transporters
  Pores ion channels [TC:1]
   LEPBI_I0297 (gstA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_C_6 GST_N_4 GluRS_N Tom37
Motif
Other DBs
NCBI-ProteinID: ABZ96441
UniProt: B0SJ18
LinkDB All DBs
Position
I:292064..292672
Genome map
AA seq 202 aa AA seqDB search
MKIYGDHQSGNCYKLQLVASFLGITYEWIQLDIKNGDTKTESFLKLNPNGKIPILVLDDG
KVLSESNAILNYLAEGSEFLPKDPYLRAKVLQWQFFEQYSHEPYIAVARFIQHYLGIPEE
RRVEYESKQSGGHKALKVMEIQLEKTPYLIGDFMTIADISLFAYTHVANEGGFDLSQYPK
INQWIERIKNQKQFIPMKSIDM
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatttacggtgatcaccaatccggtaattgttacaaactacagttagttgcatct
ttcttaggaatcacatatgaatggattcagttggatattaaaaatggagataccaaaacc
gaatcatttttaaaattaaatccgaatgggaaaataccaatacttgttttagatgatgga
aaggtattatcggaatcaaatgcaatcttaaattatttggcagagggaagtgaattccta
ccgaaggatccttacctaagagcaaaagtattacaatggcagttttttgaacaatatagc
catgaaccgtatatagctgtggctaggttcatccaacattatttaggaattcctgaagag
agaagagttgaatatgaatcaaaacaatctggagggcataaagccctcaaagtgatggaa
attcaattggagaaaactccgtatttaatcggcgattttatgacgatagcagatattagt
ttgtttgcctatacacatgtggcaaacgaaggtggatttgatttgtcgcaatatccaaaa
atcaatcaatggattgaaagaattaaaaatcaaaaacaattcattccaatgaaatcaatt
gatatgtag

DBGET integrated database retrieval system