KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I1569Help
Entry
LEPBI_I1569       CDS       T00693                                 

Gene name
glpD
Definition
(GenBank) Aerobic glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
lbi00564  Glycerophospholipid metabolism
lbi01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lbi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    LEPBI_I1569 (glpD)
Enzymes [BR:lbi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     LEPBI_I1569 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored NAD_binding_8 Pyr_redox_2 HI0933_like
Motif
Other DBs
NCBI-ProteinID: ABZ97676
UniProt: B0SQL8
LinkDB All DBs
Position
I:complement(1636932..1638539)
Genome map
AA seq 535 aa AA seqDB search
MNHLDERKQTLKQLESTQYDILILGGGATGSGTALDASLRGYKVALLEKADFSQGTSSRS
TKLIHGGVRYLAQFHFKLIYEALSERKRLLINAPHLVKPLQFVLPTYVWWEKPFYSIGLT
MYDLLAGKSIVPGHERISKATALDYFASLKKQNLKGGISYYDAQFNDARLNVTTVRAAKE
NGADVVSRIEVTNFLKDANGKIIGVTAKDAITKKVVSIKAKVVANTTGVWIDSLRKLDDP
KAENVLAPSQGIHLVFDKEKLPCRTAMIIPKTADGRVVFVIPWEGKVLLGTTDTPIQKID
DEPLPLQSEVEFLLKTGNEYLDTKLTKADIESVFSGLRPLISTGDKKDTKSISREEAILV
SDSGLVTMSGGKWSTFRKMAEDLTDKLISVGNLTSKMKCFTASFAFPGADGYSKHLVAKI
QTMYDLPYETAVRLSDAYGGEVPLILGKKPKEIKKGSGYFAEEIKHFVKKEFALSLSDVM
ARRWRILFLDLNLAESLAMQTNNILAKELGWKETEKKSSLNELLKHIKDLKKTIA
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgaaccatttagatgaaagaaaacaaacactgaaacagttagaatctacccaatatgat
attttgattttgggtggtggtgccacaggttccggcacggccctcgatgcgagcctacgc
gggtacaaagtagcccttctcgaaaaagcggacttctcgcaagggactagttcacgttcc
acaaaactcatccatggtggggttcgttaccttgcccagttccatttcaaattgatttat
gaagctttatccgaaagaaagcgccttctcatcaatgctccccacctcgtcaaacctctc
caatttgtactacctacctatgtttggtgggaaaaaccattttattccattggtctcacg
atgtatgacctactcgcaggaaagtccatcgtccctggccatgaaagaatctcgaaagca
actgcccttgattattttgcctctttaaaaaaacaaaacctaaagggtgggatatcctat
tatgatgcccagttcaatgacgcaaggctcaatgtaacaaccgttcgtgccgcaaaagaa
aatggtgcggatgtggtctcgaggatcgaagtgacaaactttttaaaagatgccaacggt
aagatcattggtgtgacggctaaagatgccatcaccaaaaaagtagtttccatcaaagcc
aaagtagtcgcaaacacaacgggggtttggattgattccctacgcaaattggatgatccc
aaagcagaaaatgtccttgctccaagccaaggcatccacttagtctttgacaaagaaaaa
ttaccatgccgcacggcgatgatcattcccaaaacggctgatggccgagtggtgtttgtc
atcccttgggaaggaaaagtattactgggaactaccgatactcccatccaaaaaatcgat
gatgaaccccttcccttacaatcggaagtggaatttttgttaaaaactggaaatgaatat
ttggataccaaattaaccaaagcagacatcgaatctgtgtttagcgggttacgaccactc
atctcgacaggtgacaaaaaagatacaaaatccatctcaagagaagaagccatccttgtc
tccgactcaggacttgtgacgatgtctggtgggaaatggtctacatttcggaagatggca
gaagacctaaccgacaaattgatctctgttggtaacctaacttctaaaatgaaatgtttt
acggcaagttttgccttcccgggagctgacggttatagcaaacacttagtagccaaaatc
caaactatgtatgacctcccatatgaaacagcggttcgtttgagcgatgcttatggcgga
gaagttccactcatccttggcaaaaaaccaaaggaaatcaaaaaaggcagtggttacttt
gcagaagagatcaaacattttgtgaaaaaggaatttgcactttccctttccgatgtaatg
gcgagacggtggaggatcctctttttggatttaaacttagcagaatcacttgcaatgcaa
acaaacaacatccttgccaaagaacttggctggaaggaaacagagaaaaaatcgtctcta
aacgaacttctaaaacacattaaggatttaaagaaaacaatcgcttaa

DBGET integrated database retrieval system