KEGG   Leptospira biflexa serovar Patoc Patoc 1 (Paris): LEPBI_I3293Help
Entry
LEPBI_I3293       CDS       T00693                                 

Definition
(GenBank) Putative zinc-binding alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lbi  Leptospira biflexa serovar Patoc Patoc 1 (Paris)
Pathway
lbi00010  Glycolysis / Gluconeogenesis
lbi00071  Fatty acid degradation
lbi00350  Tyrosine metabolism
lbi00625  Chloroalkane and chloroalkene degradation
lbi00626  Naphthalene degradation
lbi01100  Metabolic pathways
lbi01110  Biosynthesis of secondary metabolites
lbi01120  Microbial metabolism in diverse environments
lbi01130  Biosynthesis of antibiotics
lbi01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lbi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LEPBI_I3293
  09103 Lipid metabolism
   00071 Fatty acid degradation
    LEPBI_I3293
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    LEPBI_I3293
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LEPBI_I3293
   00626 Naphthalene degradation
    LEPBI_I3293
Enzymes [BR:lbi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LEPBI_I3293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C PrmA Glu_dehyd_C Methyltransf_25 ADH_zinc_N_2 2-Hacid_dh_C ThiF Methyltransf_11 NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: ABZ99358
UniProt: B0SQW1
LinkDB All DBs
Position
I:3405194..3406234
Genome map
AA seq 346 aa AA seqDB search
MKAAVLPSGSRSLEIQELDLPPLPPNQVKVKVKACGICGSDIHFILHGKMKATYSPCVPG
HETSGVVAEIGDQVTKFKLGDRVVVSAGTSCGKCKHCLAGRENLCENIGVIGFNQRGGFA
EFIQTEERYLHLLPEEIPFAEGAILADAVSTPYHAIKYQGELKAGESVAIIGCGGLGIHA
VAIAKALGAAKIYAIDIDSGSLENAKAYGADELILVEKNMQVGKVLKEKSGGIDLLCDFT
GYMPNIESSVRAMNRGGRIVLVGIGRNKLEIPMPFFLIERQIRITGSYGSDRRAIPELIQ
LYQEKKLNLTKSISGIHKLEDTNEFLHALEEKKGNPIRFIINPELS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccgccgtattaccttcgggatcgagatccctagaaatccaagaattagacctt
ccaccactcccaccaaaccaagtcaaggtgaaagtaaaagcatgtgggatctgcggatca
gacattcatttcattttacatggaaaaatgaaggccacgtattctccttgtgtacctggt
cacgaaacttcaggagttgtcgcagagattggagaccaagtcactaaatttaaattaggt
gaccgagtggtagtgagtgcggggacatcttgcggaaaatgcaaacattgtttggcagga
agagaaaatctttgcgaaaatatcggcgtcattgggttcaaccaaagaggaggatttgca
gaattcatccaaacagaagaaaggtaccttcatttattaccagaagaaattccgtttgcc
gagggagccatccttgctgatgccgtatccactccctaccatgctatcaaataccaaggt
gaattaaaagcaggcgaatcggtggccatcatcggatgtggtggactcggaatccatgca
gtggcaattgctaaagcccttggagcggcaaaaatttatgccatagatattgatagtgga
agtttagaaaatgcaaaagcatatggtgccgacgaactaatattagtcgaaaagaatatg
caagttgggaaagttttaaaagaaaagtcgggtgggatcgatctattatgcgactttact
ggttacatgccaaatattgaaagtagtgttcgtgccatgaaccgaggaggaaggattgtc
cttgtggggattggaaggaataaactcgaaatcccgatgccattttttcttatcgaaagg
caaatccgaatcacagggtcttatggttcggatcgacgggccattccagaactcatccaa
ctctatcaggaaaaaaaattgaatctcactaaatccatcagtgggattcataaactggaa
gatacgaacgaattcttacatgcgttagaagaaaaaaaagggaatcccattcgtttcatc
atcaaccctgagttatcataa

DBGET integrated database retrieval system