KEGG   Leptospira borgpetersenii JB197: LBJ_1380Help
Entry
LBJ_1380          CDS       T00404                                 

Gene name
glpA-1
Definition
(GenBank) Glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
lbj  Leptospira borgpetersenii JB197
Pathway
lbj00564  Glycerophospholipid metabolism
lbj01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lbj00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    LBJ_1380 (glpA-1)
Enzymes [BR:lbj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     LBJ_1380 (glpA-1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 GIDA Pyr_redox_2 NAD_binding_8 Thi4 HI0933_like
Motif
Other DBs
NCBI-ProteinID: ABJ75959
UniProt: Q04T11
LinkDB All DBs
Position
1:complement(1638657..1640309)
Genome map
AA seq 550 aa AA seqDB search
MQICRGKETCKAGRVLKMEKQNRTEQILKLQKESLDILIIGGGSTGTGAAFDAAKRGYKT
ALIEKKDFASGTSSRSTKLIHGGVRYLAQFHFKLIHEALTERQKLLENAPHLVKPLKFLL
PAYRFYEKPYYGIGLTLYDILASKGKLPSHKTVSKSEAVSEFAAIKKEGLFGGITYYDAQ
FNDARLNVLLARSAKKEGAIVANRVELVSFIKENGRLMGANLKDLETGKNFPVYAKVIAN
TTGIWVDHVRKLDDSRAFNVLSPSQGIHLVFSKKKIPCQSAIIIPKTKDGRVVFIIPWEN
HVILGTTDTPIENPGDEPLPIGNEVQFLLDTGNEYLENPVTEKDILAVFAGIRPLISPEG
NQDTKNISREEVILVSNSGLVTMGGGKWSTYRKMAEDLVDKLIQVGNLEIRKECSTKSYL
YPGAEGYSESLYQEIEKSYKIDTELAKRLQNYYGTEVFEILGKKPKLLGKGIPYFEEEVL
FAAKEEFALGVTDVLARRFRVLFVDLDLAKKMIEPVAGILSKQLKWNNKTKKAEESATLE
LIESLKNSYR
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatatgtagggggaaagaaacctgtaaagcaggaagagttctcaaaatggaaaaa
caaaaccgaactgaacaaattttaaaattacaaaaagaatccctagatattctcataatt
ggaggcgggtccaccggaaccggagctgccttcgacgccgcgaaaagaggctataaaaca
gccctcatagaaaagaaagattttgcctcgggaacttcctcccgttctaccaaactgatt
catggaggagtccgttatctggctcagtttcatttcaaattgatccacgaagctctgaca
gaaagacaaaaacttttggaaaacgcacctcacttggtgaaacctcttaagttcttgctt
ccagcgtatcgtttttacgaaaagccttattacggaatcggtctcactctctatgatata
ctcgcttctaagggaaaacttccctctcataaaaccgtttccaaatctgaagccgtttcc
gaatttgcagcaatcaaaaaagaaggcctcttcggaggaatcacatactacgacgctcaa
ttcaacgacgcccggttgaacgttcttcttgcaagatccgctaaaaaagaaggagccatt
gtcgccaatcgagtcgaacttgtttccttcatcaaggagaatggaagactcatgggcgct
aacctcaaggatttggaaaccggaaaaaactttccggtctatgcaaaggtaattgcgaat
acgactggaatttgggtggatcacgtccgcaaactggatgattcaagagcgtttaacgtt
ctttctccgagtcagggaatccatcttgtcttttccaaaaaaaagattccctgccaatcg
gcgataatcattcccaaaacaaaggacggaagagtcgtctttatcattccttgggaaaat
cacgtaattttaggaacgacggatactccgattgaaaatccgggagacgaacctcttccg
atcggaaacgaggttcaattcttactcgataccggaaacgaatatctggaaaatccagtc
actgaaaaagatattcttgccgtgtttgcggggatccgccctttgatttctccggaagga
aatcaggacactaagaatatttcgagagaggaagttatcctcgtctccaattccggcctg
gtcacaatgggtgggggaaaatggtctacttacagaaagatggctgaagatctagtagat
aaactaattcaagttggtaatttagaaatcaggaaagaatgttccacgaaatcttacttg
tatcccggggccgaaggttattccgagtctctctatcaagaaattgaaaaatcgtataag
attgatacggaactcgccaaaaggttacaaaattattacgggacggaagtttttgagatc
ttaggtaaaaagccgaaacttttaggcaaaggtatcccttactttgaagaggaagttttg
ttcgctgcaaaggaagaatttgcattaggcgttacagatgttttggcgagaagattcagg
gttctttttgtggatttagatctggcgaaaaagatgatagagcccgttgcgggcatactg
tccaaacagctcaaatggaataacaaaacaaaaaaagcggaagaatccgcaaccttggaa
ctgatcgaaagtttgaaaaattcgtatcgatga

DBGET integrated database retrieval system