KEGG   Lactobacillus brevis KB290: LVISKB_0581Help
Entry
LVISKB_0581       CDS       T02528                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 1
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lbk  Lactobacillus brevis KB290
Pathway
lbk00010  Glycolysis / Gluconeogenesis
lbk00260  Glycine, serine and threonine metabolism
lbk00680  Methane metabolism
lbk01100  Metabolic pathways
lbk01110  Biosynthesis of secondary metabolites
lbk01120  Microbial metabolism in diverse environments
lbk01130  Biosynthesis of antibiotics
lbk01200  Carbon metabolism
lbk01230  Biosynthesis of amino acids
Module
lbk_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lbk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LVISKB_0581
  09102 Energy metabolism
   00680 Methane metabolism
    LVISKB_0581
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LVISKB_0581
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lbk04131]
    LVISKB_0581
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lbk04147]
    LVISKB_0581
Enzymes [BR:lbk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LVISKB_0581
Membrane trafficking [BR:lbk04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LVISKB_0581
Exosome [BR:lbk04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LVISKB_0581
  Exosomal proteins of melanoma cells
   LVISKB_0581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: BAN06216
UniProt: M5AYM4
LinkDB All DBs
Position
614242..614913
Genome map
AA seq 223 aa AA seqDB search
MATLVILRHGESVANRDNIFTGWSDVPLTDRGREQAQAAGQLVAQTGIQFSALHTSMLQR
AIVTSHIVLAAIDQLYIPEYKSWRLNERHYGALRGKNKAAVQQQVGEQQVKIWRRSFSAV
PPLLDHVSQDRRYDAFGSHVEPRGESLEMAYHRLMPYWEDQVAPRLLDGQNQLIVAHGST
LRALIKYLDRVADADISQVEVANGEPIRYEFDSRLNVLDKQVL
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atggcaacactggtcatattacggcatggagagagtgtcgccaatcgcgacaatattttt
accggatggagcgatgtccccttgactgatcggggacgagaacaagctcaagcggcggga
cagttagttgcacagaccgggattcagttttcagcgttgcatacgtcaatgctccaacgt
gcaatcgtgacgtcacatattgtgctggctgcgattgatcagctgtatattccagagtat
aagtcttggcggctgaatgaacggcattatggcgccttgcgaggaaaaaataaggccgcc
gtccaacagcaggtaggtgaacagcaggttaagatttggcgacgaagcttttccgccgtt
cccccactgttagatcatgtgagtcaagatcgacgctacgatgcatttggatcgcacgtt
gagccccggggcgaaagcttagaaatggcgtatcaccgcttaatgccgtattgggaagac
caagtggccccccgattactcgatggtcaaaaccaactcattgtggcccacgggagtacg
ttacgagcgttgattaagtatcttgatcgggtggcggatgccgatattagccaggtagaa
gtggctaatggcgaaccgattcgttatgaatttgattcgcggcttaatgtattggacaaa
caagtactttaa

DBGET integrated database retrieval system