KEGG   Lactobacillus brevis KB290: LVISKB_1008Help
Entry
LVISKB_1008       CDS       T02528                                 

Definition
(GenBank) Serine/threonine-protein kinase PrkC
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lbk  Lactobacillus brevis KB290
Brite
KEGG Orthology (KO) [BR:lbk00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lbk01001]
    LVISKB_1008
Enzymes [BR:lbk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     LVISKB_1008
Protein kinases [BR:lbk01001]
 Serine/threonine kinases: Other
  Bacterial family
   LVISKB_1008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kdo RIO1 Haspin_kinase ORF_2_N Hydrolase_6 FTA2
Motif
Other DBs
NCBI-ProteinID: BAN06643
UniProt: M5ACW2
LinkDB All DBs
Position
1030371..1032380
Genome map
AA seq 669 aa AA seqDB search
MRTGYTLNDRYRIVRALGEGGMANVYLARDLILNRDVSVKLLRLDLRDDPGTIRRFQREA
LAATELVSPNIVQVYDVGEENGMQYLVMEYVEGTDLKAYIKQHFPIPYQEVIQIMEQILS
AVKTAHEHNIIHRDLKPQNILIDRNQVAKITDFGIAVALSEHNLTQTNTVLGSVHYLSPE
QARGGMVTKQSDIYSLGIILYELLTGTVPFEGETAVSIVLKHFQSEIPSVRDLDPRIPQA
LENVVLKATAKCPSDRYTDSLSMADDLRTALSPKRAGEVRFTPAVEEDGETKVLPANALS
SVAPDTEQAATTQSAPAAPATEHKVTPKGRKKTRHPRRRKFLLAGLVVLLVLLGVLIGVG
LFRPQMTNVPNITGKTEAVAKSRLRDAYLTVGTVHKTASAKVKVNRAVKTEPRFGTQLKR
QTIVDLWISTGPKRYKLANYQGDSYASTAAKLEALGFTVHRESVHSTSVPAGKIMQQSVT
AGKQVVPSRTSITLMVSTGSATVTLADLTDKTKVQAQNYATAHNLNLAFQYTYSSDVTKG
HVIRQSPGEGAVVQEGDEVTLTMSRGEQTDSSSSTDQFNVTLKIPFDEGDSDSSSDSAND
STSSSSASNLIQIYLRDQDHSLNTVYKQMTITADTTVTLPFTVVSGKAGAYKVVRDGHVI
ASDSHVTKN
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgcggacggggtacacattaaatgaccgttaccgaattgtccgagcactgggcgagggg
ggcatggcaaatgtctatttagcacgcgaccttattttgaatcgggatgtttctgtcaaa
ttgttgcggttagacttacgggatgatccgggcacaatccggcgttttcagcgtgaagca
ctcgcggcaaccgaattggttagtcccaatattgtacaagtctacgatgtgggcgaagaa
aatgggatgcagtatttggtgatggaatatgttgagggaactgacctcaaggcatatatc
aagcaacactttccaattccgtatcaagaagtcattcaaattatggagcagattctaagt
gcggtgaaaacggctcacgagcataatattattcatcgggatctgaaaccgcaaaatatt
ttgattgaccggaatcaagtcgctaaaattaccgattttggaattgcagtggccttgtcg
gagcataacctgacacagaccaatacggttttaggctcagtgcactatttatctccagaa
caagctcgtggcggaatggtgacgaagcaatctgacatctattcgctggggattattcta
tatgaacttttgaccggaacggtgccatttgaaggcgagaccgccgtgtccattgtcttg
aaacatttccagtcagagatcccgtcagttcgtgatcttgatccgcggattcctcaagca
ttggagaatgtggtgctcaaagcgactgccaagtgtcctagcgatcgatatacggatagc
ttaagtatggcggatgacttgcggacagcactatcgcctaaacgtgcgggtgaagtacga
tttacaccagcggttgaagaggatggggagaccaaggttttgccagccaatgcattaagc
tcggttgcgccagatactgagcaagcagcgacaacccaatcggctccggccgcgccggca
actgagcataaggtaacccccaaggggcgaaagaagacgcggcacccgcgccggcgaaaa
tttttactagctgggctagtggtgttattggttttgttaggtgtcttgattggtgtggga
cttttccgtccgcaaatgaccaatgtgccaaacatcactggaaaaacggaagcggtagcc
aagagccgtttgcgggatgcttacttgactgtcggaacggttcataagactgcaagcgct
aaggtcaaagtaaaccgggccgtgaaaaccgaaccgcgatttgggacgcagttgaaacgg
cagactatcgtggatctgtggatcagtacgggacctaagcgctataagctagcaaattat
caaggcgattcgtatgccagtaccgcagctaaactagaagcgttgggcttcaccgttcat
cgcgagtctgtgcactcaacaagtgtgccagcaggaaagatcatgcagcagagcgtgact
gctggtaaacaggtggtaccctcgcggacctcgataacgctaatggtttcaacgggatcg
gcaacggtcacattggctgacttaacggataaaactaaggttcaagcgcaaaactatgca
acggcgcacaacttgaatttggcctttcaatacacgtattccagtgatgtgaccaagggc
catgtcattcgccagtcaccgggtgaaggtgccgtcgttcaagaaggtgatgaggtcacc
ttaaccatgtcacgtggtgaacagaccgatagcagttctagtacggatcagttcaacgtc
accctaaaaattccttttgatgagggggactcggacagtagtagtgatagcgctaatgac
agcacgtcaagctcatcggcgtccaacctgattcagatttatttaagggatcaggatcat
tcgctaaacaccgtttataagcaaatgacgattaccgctgatacaacagtgacgttaccg
tttacggtcgtgtcagggaaagcaggagcttataaagtggttcgtgacggccacgtgatt
gcatctgatagtcatgtgacgaaaaattaa

DBGET integrated database retrieval system