KEGG   Lactobacillus brevis KB290: LVISKB_1830Help
Entry
LVISKB_1830       CDS       T02528                                 

Definition
(GenBank) Glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
lbk  Lactobacillus brevis KB290
Pathway
lbk00250  Alanine, aspartate and glutamate metabolism
lbk00430  Taurine and hypotaurine metabolism
lbk00650  Butanoate metabolism
lbk01100  Metabolic pathways
lbk01110  Biosynthesis of secondary metabolites
lbk01120  Microbial metabolism in diverse environments
lbk02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:lbk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    LVISKB_1830
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LVISKB_1830
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LVISKB_1830
   00430 Taurine and hypotaurine metabolism
    LVISKB_1830
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    LVISKB_1830
Enzymes [BR:lbk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     LVISKB_1830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: BAN07465
UniProt: M5AGC6
LinkDB All DBs
Structure
PDB: 

Position
1851136..1852542
Genome map
AA seq 468 aa AA seqDB search
MAMLYGKHTHETDETLKPIFGASAERHDLPKYKLAKHALEPREADRLVRDQLLDEGNSRL
NLATFCQTYMEPEAVELMKDTLEKNAIDKSEYPRTAEIENRCVNIIANLWHAPEAESFTG
TSTIGSSEACMLAGLAMKFAWRKRAKANGLDLTAHQPNIVISAGYQVCWEKFCVYWDIDM
HVVPMDDDHMSLNVDHVLDYVDDYTIGIVGIMGITYTGQYDDLARLDAVVERYNRTTKFP
VYIHVDAASGGFYTPFIEPELKWDFRLNNVISINASGHKYGLVYPGVGWVIWRDQQYLPK
ELVFKVSYLGGELPTMAINFSHSASQLIGQYYNFIRFGFDGYREIQEKTHDVARYLAKSL
TKLGGFSLINDGHELPLICYELTADSDREWTLYDLSDRLLMKGWQVPTYPLPKNMTDRVI
QRIVVRADFGMSMAHDFIDDLTQAIHDLDQAHIVFHSDPQPKKYGFTH
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggctatgttgtatggaaaacacacgcatgaaacagatgagacgctcaaaccaatcttc
ggggccagcgctgaacgccacgacctccccaaatataaattggcaaagcacgcgctcgag
ccccgtgaagccgatcgattggttcgcgatcaactattggatgaaggaaactcgcggctg
aatctcgccacgttctgtcagacttacatggaaccggaagcggttgaactcatgaaagat
acactggagaaaaacgccatcgataaatccgagtatcctcggaccgctgaaattgaaaat
cgttgcgttaatatcattgccaacctctggcatgctccagaagctgagtcgttcactggc
acctcgacgattggttcctccgaggcctgcatgctggccggtttggcgatgaagtttgct
tggcgtaagcgcgccaaagcgaacggtcttgacttaactgcccatcaacctaatattgtc
atctcagccggttatcaagtttgttgggaaaaattctgtgtctattgggacatcgacatg
catgtcgttcccatggacgatgaccacatgtccttgaatgtcgatcacgtgttagattac
gtggatgactacaccattggtatcgttggcattatgggcatcacttatactggacaatac
gacgatttagcccgattagatgccgttgtagagcggtacaatcggacgactaagttcccg
gtatatatccatgtcgatgccgcttccggcggattttacacgccgtttattgaacccgag
ctcaagtgggacttccgtttaaacaacgtgatttccatcaatgcctccggccacaaatat
ggcttggtttatcccggagtcggctgggtaatctggcgtgaccaacagtatctaccaaaa
gagctggtctttaaggtcagctacttgggtggtgaactacctacgatggccatcaacttc
tcccacagtgcctcccaattaatcggtcagtattacaactttattcgctttggttttgat
ggctatcgtgaaattcaagaaaaaactcacgacgttgcccgctatctcgcgaaatcgctc
actaaattagggggcttttccctcattaatgacggccacgagttaccgctgatctgttat
gaactcactgccgattctgatcgcgaatggaccctctacgatttatccgatcggttatta
atgaagggctggcaggttcccacctatcccttaccaaaaaacatgacggaccgcgttatt
caacggatcgtggttcgggctgactttggtatgagtatggcccacgactttattgatgat
ctaacccaagccattcacgatctcgaccaagcacacatcgttttccatagtgatccgcaa
cctaaaaaatacgggttcacgcactaa

DBGET integrated database retrieval system