KEGG   Lactobacillus brevis KB290: LVISKB_2222Help
Entry
LVISKB_2222       CDS       T02528                                 

Definition
(GenBank) L-threonine 3-dehydrogenase
Organism
lbk  Lactobacillus brevis KB290
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 PglD_N NAD_binding_3 Shikimate_DH ADH_N_2 DUF1188 F420_oxidored
Motif
Other DBs
NCBI-ProteinID: BAN07857
UniProt: M5AHN2
LinkDB All DBs
Position
complement(2218194..2219195)
Genome map
AA seq 333 aa AA seqDB search
MKALVLTGTKQFEMQDVTTPTVKDDEVLVNTAYAGICGTDRALYAGLPGSADAVPPIVLG
HENSGIVAAIGRNVTNVKVGDRVTVDPNIYCGECEYCRTDRPELCDNLSAVGVTRDGGLE
ESFTAPASVVYPIPDSVSLKAAATVEPISCAVHGVKLLDLTPYQKALVIGDGFMGQLFVQ
LLQAYGVHQVDFAGIVDEKLAFNKEKFGVTNTYNTTRDSIPADYDVVIEAVGLPQTQEQA
VEATKKGAQVLMFGVGKPNQTFSMNTYEVYQKQLKIQGAFINPYAFEDAIALLASGQLDV
ESLISHEVSLEQVEDVLNGKVEHVSKAVVKVSD
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctttagttttaacgggtacaaaacaatttgagatgcaagatgtcacgacacca
actgtcaaagacgatgaagtcttagtgaataccgcttatgcagggatttgtgggactgac
cgggccttatacgctggtcttccaggttctgcggatgctgtgccacccattgttttaggt
catgaaaattccggaattgttgccgcaattgggcgtaacgtgaccaacgtgaaagtgggc
gaccgggtgaccgttgaccctaacatttactgtggcgaatgtgaatactgccggactgat
cggccagaattgtgtgacaacttatcagccgttggggtgacccgtgatggtggtttggaa
gaaagcttcacagctcctgcttccgttgtttaccccattcctgacagtgtttcactgaag
gcagcggccacggttgaaccaatctcctgtgccgttcacggggtcaagttacttgatctc
accccttatcaaaaggctttggttattggggatggctttatgggacaactctttgtccaa
ttactgcaagcctatggcgttcaccaagttgatttcgccgggattgttgatgaaaagtta
gcctttaacaaggaaaaatttggcgtcactaacacatacaacaccactcgtgacagcatt
ccagctgactacgacgttgtgattgaagcggttggtctgccacaaacgcaagaacaagcc
gttgaagccactaagaagggcgcacaagtgctgatgtttggggtcggtaagcctaaccaa
acgttctcaatgaatacgtatgaagtttaccaaaagcaattgaagatccaaggggccttc
atcaacccatatgcatttgaagatgccattgctttgttggcaagtgggcaattggacgtg
gaatctttgatcagccacgaagttagtctagaacaagttgaagatgtcttgaacggcaaa
gtggaacatgtcagcaaggcagttgtgaaggtcagcgactag

DBGET integrated database retrieval system