KEGG   Lactobacillus brevis KB290: LVISKB_2248Help
Entry
LVISKB_2248       CDS       T02528                                 

Definition
(GenBank) Pyrimidine-specific ribonucleoside hydrolase rihB
  KO
K10213  ribosylpyrimidine nucleosidase [EC:3.2.2.8]
Organism
lbk  Lactobacillus brevis KB290
Pathway
lbk00230  Purine metabolism
lbk00240  Pyrimidine metabolism
lbk01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbk00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    LVISKB_2248
   00240 Pyrimidine metabolism
    LVISKB_2248
Enzymes [BR:lbk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.8  ribosylpyrimidine nucleosidase
     LVISKB_2248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IU_nuc_hydro
Motif
Other DBs
NCBI-ProteinID: BAN07883
UniProt: M5AGD9
LinkDB All DBs
Position
complement(2244004..2244939)
Genome map
AA seq 311 aa AA seqDB search
MMAKRKIILDCDPGHDDAVAMLMAYAHPSIDLLGITIVAGNQTLAKTVRNGLNVAQLLEM
NVKIYPGMPQPLVRDQVVAGNVHGTTGLDGPVFGELNRQPATKNGVQFIIDTLLASDGDI
TLVPTGPMTNIASAMRAEPLIIPKIKEIVMMGGAYGTGNFTPSAEFNIYADPEAANVVFR
SGVPIVMMGLDLTNQTVCTPDIIDRMEAVGNKAGKLFGDMLRFTLKTQYEEFGLEAGPIH
DATTIGYLIDPDLFETQDEFVVVDINRGPCYGRTVCDENNVLKQQPNAKVGQKINHDGFF
DLVEDCIRLYS
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgatggcaaaacgaaagattattttagattgtgatccgggacatgatgatgcggtggcg
atgctaatggcatatgcccaccccagtattgatttattagggattacgattgtggcgggg
aaccaaaccttagcaaaaacggtccgcaatggtttgaatgtcgcgcaattattagaaatg
aacgttaaaatttatccggggatgccacagcctttagtgcgagaccaagtagtagccggt
aacgttcacggaactactgggttagatggtcccgtctttggcgaattaaaccggcaacca
gcaactaaaaatggagttcaattcattatcgatacgttgttagctagtgatggtgacatt
actttggtaccaaccggaccaatgactaatattgcgagtgccatgcgtgcggagccactg
attattcctaagattaaagaaatcgtgatgatgggtggggcctatggaaccggtaatttt
acgccatcggctgaatttaacatttacgctgaccctgaggccgccaacgttgtctttaga
tcaggtgtgccaatcgtcatgatggggcttgatttgaccaatcaaaccgtttgtacgcca
gatatcattgaccgcatggaagcggttggtaataaggcggggaaactctttggtgatatg
ttgcggtttacactcaaaacgcagtatgaagaatttggattggaagccgggccaattcac
gatgccacgaccattgggtatctaatcgatcccgatctctttgaaacgcaggatgaattt
gtggtggtcgatattaaccgggggccttgttatggtcgaacggtttgcgatgaaaacaat
gttttaaagcaacaacctaacgccaaggtcggccaaaagattaatcatgatggcttcttt
gacctggttgaagactgtatccgactgtattcataa

DBGET integrated database retrieval system