KEGG   Leptospira borgpetersenii L550: LBL_1338Help
Entry
LBL_1338          CDS       T00405                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lbl  Leptospira borgpetersenii L550
Pathway
lbl00473  D-Alanine metabolism
lbl00550  Peptidoglycan biosynthesis
lbl01100  Metabolic pathways
lbl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lbl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LBL_1338 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LBL_1338 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    LBL_1338 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lbl01011]
    LBL_1338 (ddlA)
Enzymes [BR:lbl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LBL_1338 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:lbl01011]
 Precursor biosynthesis
  Amino acid ligase
   LBL_1338 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp_4 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: ABJ78830
UniProt: Q052B5
LinkDB All DBs
Position
1:1571333..1572388
Genome map
AA seq 351 aa AA seqDB search
MAKIAVFFGGSSTEHSISIRTGCFICRTLHTMGHSVKPILLTQDGGWVVPLQYRISIPYE
AVNSSDLFEEEFQKTNGVSKMDFISNLDADIVFLGLHGGKGEDGSIQGFLRVLGVPYTGS
GVAASALAMDKTRANQIFLQSGQKVAPFFEVEKLGYTNSPEETVIKLMSLGFPQFLKPVE
GGSSVSTYKITNQEQLSRQLALIFESDSKVMSQSFLAGTEVSCGVLERYRNGKLERIALP
ATEIVPGGEFFDFESKYKQGGSREITPARISKQEMTRVQELAIDAHTSLGCRGYSRSDFI
IVGGEPHILETNTLPGMTETSLIPQQAKAAGITMEEVFADLIEIGLKHSIH
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
ttggctaagatcgcggttttttttggtggtagttctacggaacacagtatttcgattcga
acaggttgttttatttgtaggactctgcatacgatggggcattcggtcaaacccattctc
ttgactcaggacggaggttgggtggttcctttacaatatcggatatcaattccatatgaa
gcggtgaattcttcggatttgtttgaggaagaatttcaaaaaacaaacggtgtatctaaa
atggattttatttccaacttggatgcggatatcgtttttctcggtcttcacggcggaaaa
ggagaagacggaagtattcaaggtttcctaagagttctgggggttccttataccggttcc
ggggtcgccgcttccgcgcttgcaatggataaaaccagagccaatcagatttttttacaa
tccggtcaaaaggtcgctcctttttttgaagtcgagaagttaggatatacgaattctccc
gaagaaactgtcatcaagttgatgagtttgggatttcctcagtttttaaagccggtggaa
ggtggctcgagtgtttccacgtataaaattacgaaccaagaacaactttcccgccagctt
gctcttatatttgaatccgattccaaagtaatgagccagtcctttctggctggaaccgaa
gtttcctgcggagttttggaaagatatagaaacggaaagttggaacggatcgcgttaccc
gcgactgaaatcgttcccggaggggaatttttcgacttcgaatctaaatacaaacaaggc
ggttcacgcgagattactcccgcaaggatttcgaaacaggagatgacgcgtgtacaggaa
cttgcaatagacgcacacacgtctctcgggtgcaggggatactcaagaagcgattttatc
attgtaggcggggaacctcatattctggaaaccaacacgttacccggaatgacggagacc
agcttgattccgcaacaagcaaaagccgcgggaattacgatggaggaagtgtttgctgac
ctgatagagatcggactgaaacattctatccattag

DBGET integrated database retrieval system