KEGG   Lactobacillus buchneri CD034: LBUCD034_0054Help
Entry
LBUCD034_0054     CDS       T02244                                 

Definition
(GenBank) transcriptional regulator, PurR family
  KO
K02525  LacI family transcriptional regulator, kdg operon repressor
Organism
lbn  Lactobacillus buchneri CD034
Brite
KEGG Orthology (KO) [BR:lbn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lbn03000]
    LBUCD034_0054
Transcription factors [BR:lbn03000]
 Prokaryotic type
  Helix-turn-helix
   LacI family
    LBUCD034_0054
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_3 Peripla_BP_4 LacI Peripla_BP_1 ANF_receptor HIT PTCB-BRCT NLBH
Motif
Other DBs
NCBI-ProteinID: AFR99167
UniProt: J9VXH3
LinkDB All DBs
Position
complement(59581..60552)
Genome map
AA seq 323 aa AA seqDB search
MAGVSTATVSRYLNGHFEKMSDETRVKVQHVINDTGYHINRQAQSLKNQTTHLIGMVVAD
IENIFSSILFKGADKIFEQHGYQILLMNSDNSGDREHDQLQRLLDLQVDGIILQPIHNNS
ASYQFIKDTDTPTVIVDRKTTPQIWPEVTTDNYGYSKALSDLIIRMGYKRIVTISEPLAD
NEVRMDRYHAVQEAAKGTDVIVDSIEITENTSDDLIYNQIMRKTDSLKTKAVVYALKGTV
LMRVIKLLSKFHILIPKDIGVTAFDDWDWAQLMQPEITTIQQNPKKMGQKSAELLIDLIS
DQPIVEKTVLVESELKIRNSIID
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggctggagtttccactgcaaccgtctcgcgatacttgaacggtcactttgaaaaaatg
tctgatgaaactcgggttaaagttcagcatgtaatcaatgacactggctatcacatcaat
cgtcaagcacagtcattaaagaaccaaaccacgcatttaattggaatggtcgtcgctgat
attgaaaatattttctcctcgattttatttaagggagccgataaaatcttcgagcagcat
ggctatcaaatattattgatgaactcggacaactctggtgatcgggaacatgatcagctc
caacggcttttggatcttcaagtcgatggcattatcctgcaaccgattcataataacagt
gccagttaccaatttattaaagataccgatacaccaacggttattgttgatcgaaaaaca
acgccgcaaatctggccagaagtaactaccgacaactatggctattcaaaggcattgtcg
gacttgataattcgtatgggatataaacgaattgtcaccatcagtgaaccgctagctgat
aatgaagtgcggatggatcgttaccacgccgttcaagaggccgccaagggcaccgatgtc
atcgtagacagtatcgaaataactgaaaatacctctgatgatttgatttataatcagatc
atgagaaaaactgattccttgaagaccaaagcggttgtctatgccctcaaaggaactgtt
ctaatgcgtgtcataaagttgttatcaaaattccatattctaatcccaaaagatattggt
gtaacagcatttgatgattgggattgggcgcaattaatgcagccggagatcaccaccatt
cagcagaatccaaagaaaatgggacaaaaatctgctgaactattgattgacctcatctcc
gaccaaccgattgtagaaaaaacagtgcttgttgaaagtgagctcaaaattcgaaattca
atcattgattaa

DBGET integrated database retrieval system