KEGG   Leptolyngbya boryana: LBWT_10140Help
Entry
LBWT_10140        CDS       T04848                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
lbo  Leptolyngbya boryana
Pathway
lbo00500  Starch and sucrose metabolism
lbo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LBWT_10140
Enzymes [BR:lbo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     LBWT_10140
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     LBWT_10140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C DUF3459
Motif
Other DBs
NCBI-ProteinID: BAS55109
LinkDB All DBs
Position
1119740..1122958
Genome map
AA seq 1072 aa AA seqDB search
MMQFSTLNYDPQWYKDAIIYEVPVRAFSDSNNDGIGDFVGLTGKLDYLQSLGVTALWILP
FFPSPLRDDGYDISDYTSVNPIYGTIEDFQAFLEAAHARGIRVIIELIINHTSDQHPWFQ
RARRAPVGSPERDFYVWSDTPDKYQEARIIFQDFETSNWTWDSVANAYFWHRFYSHQPDL
NYDNLAVQQAVFEVLDFWLAMGVDGLRMDAVPYLYEREGTNCENLPETHAFLKKLRKHVE
SNYPECMLLAEANQWAEDAAAYYGDGDECHMNFHFPLMPRLFMSVRMEDSFPINDILQQT
PPIPENCQWGIFLRNHDELTLEMVTDEDRDYMYRVYAQDKEMRVNLGIRRRLAPLLGNDR
RQIELLNSLLLTFPGTPVLYYGDEIGMGDNVYVGDRNGVRTPMQWSDDRNAGFSRANPHK
LYLPIIVDSEYNYTTVNVEAQRSNPNSLLSAMRRLIATRKRFQAFGRGDFQLLHPENRKV
LAFTRTYKDECILVVANLSRFVQTVELDLSAFSGSIPVEVFGRTEFPAVKEAPYFLSLGA
YAFYWFSLKPVDSSTQTELPTIRSTWETLLARSSSRAKLENILVDHFKQYRWFKARTQSV
QSAQIIEMIPISPEVQLIWLQVSYIQEQPETYVMFIAHGDRELDASVIAQLEEGVLFEAV
TDPTFLTILLSLLRHGVQATGEFGQLKSTTVNLPNSFEACLLKGEHNNTSILYGESVKTG
AEAELLLKIFRHVEEGMNPDLEIRRFLDSKFNHIPRILGSIEYQIPGRAPMTIAVLQEFI
AGAQSTWDYTLDSLRTYFESLNNHEVPEVATLEDIPDFIQTAIGTYLANIQLLGQRTAEL
HLALATESEHPDFKPEPFTSLYQRSIYQYARNLTGRVFLALRNQLHHIADPLLARDVLEL
YEPCLEQFRGILDQKITALRTRYHGDYHLGQALYTGKDFVLIDFEGNSLRSLSDRRIKRS
PLRDAAGMMQSFHVAAEIALANEISTAEHSPSQLKKMKQGAQHWKYWAGGTFLKSYFETA
QSGKFLPQSSDELKRLLNHYLLEKAIASLGKELNERSDKIEIALLRILELLN
NT seq 3219 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagttctccacactcaattacgatccgcaatggtacaaagacgcaatcatctac
gaagttcccgtccgcgctttttcagatagtaataatgatggcattggagattttgtcggc
ttaactggaaagctagattatctccagagtttaggagtaactgcgctttggatactgccc
ttctttccttcgcctctgcgagatgatgggtatgacatttcggactatacgagcgtcaat
cccatttatggcacgatcgaggattttcaagcgtttctagaagcggctcatgcgcgtgga
attcgggtgatcatcgaactaattatcaaccacacgtctgatcaacatccctggtttcaa
agggcgcgacgtgcgcctgtcggttcacccgaacgagatttttatgtatggagcgatacc
ccagataagtaccaggaagctcgaattatttttcaagatttcgagacttctaactggaca
tgggattccgtcgcaaacgcctacttttggcatcgcttctactctcaccagcctgatttg
aactatgacaatctggctgttcagcaagccgtttttgaggtgctcgatttctggctggcg
atgggcgtagatggcttgcgcatggatgctgtaccttacttatacgaacgagaaggaacc
aactgcgagaatctccctgaaacccatgctttcttgaagaagctacgcaagcatgtggaa
tcgaactatccagagtgcatgttgcttgcagaagccaatcagtgggctgaagatgctgct
gcctactatggcgatggcgatgaatgtcatatgaactttcattttccattgatgccgcgc
ttgtttatgtctgtgcgaatggaagatagctttccgatcaatgacattctgcaacagact
ccaccaattcctgaaaactgtcagtggggcattttcttgcggaatcatgatgaactgacg
ctggaaatggtgacggatgaagatcgagattatatgtatcgggtctatgctcaagacaaa
gagatgcgggtgaatttgggaattcggcggagattagcaccattactcggtaacgatcga
cgacagatcgaactgctcaacagtctcttactgacttttccgggtacacctgtgctgtac
tatggcgatgagattggtatgggggacaatgtgtatgtgggcgatcgcaatggggtgaga
actccgatgcagtggagtgacgatcgcaatgccggattcagtcgcgcgaatcctcataaa
ctatacttaccaatcattgtggattctgagtacaactatacgacggtgaatgttgaagct
cagcgatcgaatccgaactctctgctcagtgcaatgcgccgcctcattgcaactcgtaag
cgctttcaggcattcggacggggtgactttcaactgttacacccagaaaatcgcaaagtt
ctagctttcactcgcacgtataaagatgaatgtattctggttgtggcaaatctgtcacga
tttgtgcaaacggttgagctagatctctctgctttctcaggttcgattccagtggaagtg
tttggacggactgagtttccagcggtgaaagaggctccttacttcttgagcttaggagct
tacgctttctactggttcagtctaaagcctgttgattcttcaactcaaacagaacttccc
acaattagaagcacctgggagacattgctggctcgttctagtagcagagcaaagctagaa
aatattctagttgatcactttaaacaatatcgttggttcaaggcgagaacgcaatcggtt
caatcggctcaaattattgaaatgattccgatctcccctgaggttcaactcatttggctg
caagtaagctacattcaagagcaacccgaaacgtatgtgatgtttattgcgcatggcgat
cgcgaactcgatgcttctgtgattgctcagcttgaggagggtgttttatttgaggcggtg
actgatccaacttttctgactatcttactcagtctcttgcgacatggtgtgcaagcaacg
ggagagtttggacaactgaagtcaacgactgtcaatcttcccaattcttttgaagcttgt
ttacttaaaggcgagcataacaatacttcgattctctacggcgaatctgtcaaaactggg
gcagaagctgaacttcttctaaaaatattccgtcacgttgaagaggggatgaatccggat
ctcgaaatccgtcgatttctcgattcaaagttcaaccatattccccgaattctaggctcg
atcgagtatcaaattcctggacgcgctccgatgacgatcgcggttcttcaagagttcatt
gcaggagcgcaaagcacttgggactatactctcgacagtcttcgcacctacttcgagtcg
ctgaacaatcatgaagttcctgaagttgcgacgctagaggatattcctgattttattcaa
actgcgatcggaacttatctcgcgaatattcaactcctaggacaacgaactgctgaattg
catcttgcattagctactgagtctgaacatcctgacttcaagccagaaccttttacgtcg
ttgtatcagcgatcgatttaccaatacgctcgcaatctcacaggacgagtctttttagca
ctcagaaaccaacttcatcacattgctgatccgttactagcgcgcgatgttttagaacta
tacgagccttgtctagaacagtttcgcggcattttagatcagaagattacagctttgcgg
actcgatatcatggcgactatcatctgggtcaagcgctctatacgggcaaagactttgtt
ctgatcgatttcgaggggaattcgttgcggagcttaagcgatcgacgaattaaacgttct
ccgctcagagatgctgcggggatgatgcaatcgtttcatgttgcggctgaaattgcttta
gccaatgagatcagcacggctgagcattcaccgagccaactcaagaagatgaaacaaggg
gcacagcattggaagtattgggcaggcggaactttcctcaagtcatattttgagacggca
cagtcggggaaatttttacctcaaagcagtgatgaattaaagcgattgctcaatcactat
ttactagaaaaagcgatcgcatctttaggtaaagaattaaatgagcgatcggacaaaatc
gaaatcgctctcctccgaatccttgaactgttgaattaa

DBGET integrated database retrieval system