KEGG   Leptolyngbya boryana: LBWT_24770Help
Entry
LBWT_24770        CDS       T04848                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase, large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
lbo  Leptolyngbya boryana
Pathway
lbo00630  Glyoxylate and dicarboxylate metabolism
lbo00710  Carbon fixation in photosynthetic organisms
lbo01100  Metabolic pathways
lbo01120  Microbial metabolism in diverse environments
lbo01200  Carbon metabolism
Module
lbo_M00165  Reductive pentose phosphate cycle (Calvin cycle)
lbo_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
lbo_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:lbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    LBWT_24770
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    LBWT_24770
Enzymes [BR:lbo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     LBWT_24770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: BAS56554
LinkDB All DBs
Position
2656756..2658186
Genome map
AA seq 476 aa AA seqDB search
MSYAQTKTQSKAGYKAGVQDYRLTYYTPDYTPKDTDILAAFRVTPQPGVPPEEAAAAVAA
ESSTGTWTTVWTDLLTDLDRYKGRCYDIEPVRGEDSQFIAYIAYPLDLFEEGSVTNLLTS
LVGNVFGFKALKALRLEDLRIPVAYLKTFQGPPHGIQVERDKINKYGRPMLGCTIKPKLG
LSAKNYGRAVYECLRGGLDFTKDDENINSQPFQRWRDRFLFVADAIHKAQAETGEIKGHY
LNVTAATCEEMLKRAEFAKELEMPIIMHDFLTGGFTANTSLAHWCRDNGVLLHIHRAMHA
VIDRQKNHGIHFRVLAKCLRMSGGDHIHTGTVVGKLEGDKAITLGFIDLLRENYIERDPS
RGVYFTQDWASMPGVMAVASGGIHVWHMPALVEIFGDDSVLQFGGGTLGHPWGNAPGATA
NRVALEACVQARNEGRDLMREGGDIIREACRWSPDLAAACELWKEIKFEFEAVDTV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacgctcaaaccaaaacccagtcgaaagctgggtataaggctggggtacaagat
taccgcttaacgtactacaccccagactacacgcctaaagacaccgatattttggcagcg
ttccgggtgactcctcaacctggcgttccgcccgaagaagctgctgctgctgttgctgct
gaatcctcaacgggaacatggacgaccgtttggacggacttgctgaccgacctcgatcgc
tacaaaggacgctgctacgatatcgagcctgtccgtggcgaagatagccaattcattgct
tacattgcatatcctctcgacctgtttgaagaaggatctgttaccaacttgctgacctct
ttggtcggtaacgtattcgggttcaaagcgttgaaagcgctgcgcctcgaagaccttcgc
attccggttgcatacttgaagaccttccaaggtcctcctcacgggattcaagttgaacgc
gacaaaatcaacaaatacggtcgtccgatgctcggttgtacgatcaaaccgaaactgggt
ctgtccgctaagaactacggtcgtgcagtttacgaatgtctgcgcggcggtttggacttc
accaaagacgacgaaaacatcaactcgcagccgttccaacgttggcgcgatcgcttcttg
ttcgttgcagatgcaatccacaaggcacaagctgaaaccggcgaaatcaaaggtcactac
ctgaacgtaaccgctgcaacctgcgaagaaatgctgaagcgtgcagagttcgcgaaagaa
ctcgaaatgccgatcatcatgcatgacttcttgaccggtggtttcacagcaaacacctcc
ttggctcattggtgtcgtgataacggcgttctgttgcacattcaccgcgcaatgcacgca
gttatcgaccgtcagaagaaccacgggatccacttccgcgtcttggcgaagtgcttgaga
atgtctggtggtgaccacattcacaccggaaccgtcgttggtaagctcgaaggtgacaag
gcgatcacccttggtttcatcgacttgctgcgtgagaactacattgagcgcgatccttcc
cgtggtgtttacttcacccaagactgggcttccatgcctggtgtcatggcagttgcttct
ggtggtatccacgtatggcacatgcctgcgttggttgaaatcttcggcgacgactctgta
ttgcagttcggtggtggaaccttgggtcacccatggggtaacgcacctggtgcaacggct
aaccgtgttgcgctcgaagcttgcgtccaagctcgtaacgaaggtcgcgacttgatgcgt
gaaggtggagacatcatccgtgaagcttgccgctggtcgcctgacttggcagctgcttgc
gaactctggaaagaaatcaagttcgagttcgaagctgttgataccgtctga

DBGET integrated database retrieval system