KEGG   Leptolyngbya boryana: LBWT_6640Help
Entry
LBWT_6640         CDS       T04848                                 

Definition
(GenBank) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lbo  Leptolyngbya boryana
Pathway
lbo00010  Glycolysis / Gluconeogenesis
lbo00020  Citrate cycle (TCA cycle)
lbo00620  Pyruvate metabolism
lbo01100  Metabolic pathways
lbo01110  Biosynthesis of secondary metabolites
lbo01120  Microbial metabolism in diverse environments
lbo01130  Biosynthesis of antibiotics
lbo01200  Carbon metabolism
Module
lbo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBWT_6640
   00020 Citrate cycle (TCA cycle)
    LBWT_6640
   00620 Pyruvate metabolism
    LBWT_6640
Enzymes [BR:lbo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LBWT_6640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: BAS54767
LinkDB All DBs
Position
711402..712691
Genome map
AA seq 429 aa AA seqDB search
MIHEIFMPALSSTMTEGKIVSWLKAPGDKVEKGETVVVVESDKADMDVESFYEGFLATIV
VDAGNSAPVGSAIALLAETEAEIEAAKQQATQTTPSAPAATAAATTPTPEPVAAAATNGS
SSAPTQNGRIVASPRARKLAKELKVELGAVVGSGPHGRIVAEDIEKAAGKTPTVKPAAKP
AAPVAPAVAAAPAPRAASAPVAPTQPGQIKPMTTLQTAVVRNMNASLDVPVFRASYTITT
DALDKLYKQVKSKGVTMSALLTKAIAMALQKHPLLYASYVENGIHFNESINIANAVAMED
GGLITPVLKNADQQDLYSLSRNWKDLVDRARSKQLQPDEYSSGTFTVSNLGMFGVDAFDA
ILPPGQGAILAIGASRPTVVATDDGLLGVRRQMQVNITCDHRIIYGADAAIFLRDLAKLI
ETDVQSLTL
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgatccacgaaatttttatgcccgccctcagttccaccatgaccgaaggaaaaatcgtg
tcctggctcaaagctccgggcgacaaagttgagaaaggtgaaaccgttgtggtggttgag
tctgacaaggctgacatggacgtagaatccttttatgaaggatttttagctacgatcgtc
gttgatgcaggcaactcagctccggtcggatctgcgatcgcgctcttagctgaaaccgaa
gccgagatcgaagccgcgaaacaacaagcaacccaaactactcccagcgctccggctgcc
accgctgctgcgacaacacccactccagaacctgtggcagcggctgccaccaatggctca
tctagtgcgccgactcaaaacggacgcatcgttgcttctccacgcgcacggaaactcgca
aaagaattaaaagttgaactgggtgctgtggttggaagtggtccgcacggtcggattgtg
gcagaagatatcgaaaaagctgctggcaaaaccccaaccgtcaaacctgccgcaaaacct
gctgcacctgttgcgcctgctgttgccgctgcacctgctccaagagcagcgtctgcacct
gttgctccaacccaacccggtcaaatcaagccgatgacgaccttgcaaaccgcagtcgtc
cggaatatgaatgcaagtttagatgttccagtcttccgcgcttcctacacgattacaacg
gatgcactcgacaaactgtacaagcaggtgaaatccaagggcgtaacgatgtcagccttg
ctgacaaaagcgatcgcgatggcgttgcaaaaacatcctttactgtatgcaagctatgtt
gagaacggtattcactttaatgaatcaatcaacattgcaaatgcagttgcaatggaagat
ggtgggttgatcactcctgtattgaaaaatgcagatcagcaagatctttactcgctgtct
cggaactggaaagatttagtcgatcgtgcaagatcaaaacaactccaacccgatgaatat
agttctggaacgttcacagtctcgaacttaggcatgtttggtgtggatgcgtttgatgca
atcttgccaccaggacagggagcgattttagcgatcggcgcatctcgtccaaccgtagtt
gcaaccgatgatggactgctcggagtacgccgacaaatgcaggtaaatatcacttgcgat
caccgcattatttacggtgctgatgcggcaatcttcttgcgtgatttagcaaaactgatt
gaaaccgatgttcaatcgttgacgctgtaa

DBGET integrated database retrieval system