KEGG   Leptolyngbya boryana: LBWT_6640
Entry
LBWT_6640         CDS       T04848                                 

Definition
(GenBank) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lbo  Leptolyngbya boryana
Pathway
lbo00010  Glycolysis / Gluconeogenesis
lbo00020  Citrate cycle (TCA cycle)
lbo00620  Pyruvate metabolism
lbo01100  Metabolic pathways
lbo01110  Biosynthesis of secondary metabolites
lbo01120  Microbial metabolism in diverse environments
lbo01200  Carbon metabolism
Module
lbo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lbo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBWT_6640
   00020 Citrate cycle (TCA cycle)
    LBWT_6640
   00620 Pyruvate metabolism
    LBWT_6640
Enzymes [BR:lbo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LBWT_6640
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Other DBs
NCBI-ProteinID: BAS54767
LinkDB
Position
711402..712691
AA seq 429 aa
MIHEIFMPALSSTMTEGKIVSWLKAPGDKVEKGETVVVVESDKADMDVESFYEGFLATIV
VDAGNSAPVGSAIALLAETEAEIEAAKQQATQTTPSAPAATAAATTPTPEPVAAAATNGS
SSAPTQNGRIVASPRARKLAKELKVELGAVVGSGPHGRIVAEDIEKAAGKTPTVKPAAKP
AAPVAPAVAAAPAPRAASAPVAPTQPGQIKPMTTLQTAVVRNMNASLDVPVFRASYTITT
DALDKLYKQVKSKGVTMSALLTKAIAMALQKHPLLYASYVENGIHFNESINIANAVAMED
GGLITPVLKNADQQDLYSLSRNWKDLVDRARSKQLQPDEYSSGTFTVSNLGMFGVDAFDA
ILPPGQGAILAIGASRPTVVATDDGLLGVRRQMQVNITCDHRIIYGADAAIFLRDLAKLI
ETDVQSLTL
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgatccacgaaatttttatgcccgccctcagttccaccatgaccgaaggaaaaatcgtg
tcctggctcaaagctccgggcgacaaagttgagaaaggtgaaaccgttgtggtggttgag
tctgacaaggctgacatggacgtagaatccttttatgaaggatttttagctacgatcgtc
gttgatgcaggcaactcagctccggtcggatctgcgatcgcgctcttagctgaaaccgaa
gccgagatcgaagccgcgaaacaacaagcaacccaaactactcccagcgctccggctgcc
accgctgctgcgacaacacccactccagaacctgtggcagcggctgccaccaatggctca
tctagtgcgccgactcaaaacggacgcatcgttgcttctccacgcgcacggaaactcgca
aaagaattaaaagttgaactgggtgctgtggttggaagtggtccgcacggtcggattgtg
gcagaagatatcgaaaaagctgctggcaaaaccccaaccgtcaaacctgccgcaaaacct
gctgcacctgttgcgcctgctgttgccgctgcacctgctccaagagcagcgtctgcacct
gttgctccaacccaacccggtcaaatcaagccgatgacgaccttgcaaaccgcagtcgtc
cggaatatgaatgcaagtttagatgttccagtcttccgcgcttcctacacgattacaacg
gatgcactcgacaaactgtacaagcaggtgaaatccaagggcgtaacgatgtcagccttg
ctgacaaaagcgatcgcgatggcgttgcaaaaacatcctttactgtatgcaagctatgtt
gagaacggtattcactttaatgaatcaatcaacattgcaaatgcagttgcaatggaagat
ggtgggttgatcactcctgtattgaaaaatgcagatcagcaagatctttactcgctgtct
cggaactggaaagatttagtcgatcgtgcaagatcaaaacaactccaacccgatgaatat
agttctggaacgttcacagtctcgaacttaggcatgtttggtgtggatgcgtttgatgca
atcttgccaccaggacagggagcgattttagcgatcggcgcatctcgtccaaccgtagtt
gcaaccgatgatggactgctcggagtacgccgacaaatgcaggtaaatatcacttgcgat
caccgcattatttacggtgctgatgcggcaatcttcttgcgtgatttagcaaaactgatt
gaaaccgatgttcaatcgttgacgctgtaa

DBGET integrated database retrieval system