KEGG   Leptolyngbya boryana: LBWT_8600Help
Entry
LBWT_8600         CDS       T04848                                 

Definition
(GenBank) Major facilitator superfamily protein
Organism
lbo  Leptolyngbya boryana
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 Sugar_tr MFS_3 OATP
Motif
Other DBs
NCBI-ProteinID: BAS54959
LinkDB All DBs
Position
complement(928024..929265)
Genome map
AA seq 413 aa AA seqDB search
MEFQFMPFLPRLQHQVWLLAFGRLLSQVGTGFTLFYAPIFFVNQVGLSATAVGVGIGSAS
ISGVVGRVLGGTFADSKFWGRRRTLLMSAMISAIASFTFATAYDFPVFVLGNLLMGLGTG
LYWPATEATVADLTTPEQRNEAYSITRLADTLGLGIGVVLGGLLISTTGAYRALFVVDGI
SFLIFLIVIYFMIQETQRLIYSHSQWSGWKVALSDRRLLTFAIVNTMFTTYIVQIDSTLP
LYLTNFVKINGDKGFEPSTISILYTAYLALSVLIQLPMTRFLNSFRRTRVLIMSAGCWAI
AFTLVWVTGAFHFAWAVAVFGVLAVALVTYLPSASAFVVDLAPESLRGVYLGINSQCWAL
GYFIGPPLGGWALDQSRAIASGYWLFLVATVAIAVLILRVLDKMVSQTPSHRL
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atggaatttcaatttatgccttttctccctcgtcttcagcatcaggtttggttacttgcc
tttggtcgcttactctctcaagttggaactggattcaccctcttctacgctccgattttc
tttgtcaatcaggtgggactctctgctacagccgttggagtcggaatcggcagcgcctct
atctcaggcgttgttggacgggtattggggggcacgtttgcagattctaagttttgggga
cgcagacggacgttgttgatgtcggcgatgatttcagcgatcgcgtctttcacctttgcg
acggcttatgatttcccagtctttgtgcttggcaatctgttgatggggttgggaactgga
ctttactggcctgcgacagaagcgacggttgcagacctgaccacacccgaacaacgcaat
gaagcctattcgattactcggctcgccgatacgttaggactgggaattggagtagtgtta
ggcggattgttaatcagtacgacaggagcctatcgggcactatttgtagtagatggaatt
tcgtttctcattttcttaattgtgatttatttcatgattcaagaaacgcagcgattgatt
tattctcattctcaatggagcgggtggaaagttgccttgagcgatcgccgattattgact
ttcgcgatcgtcaatacgatgtttacaacttacatcgtgcaaattgatagtacgttaccg
ttgtatctcacgaatttcgtcaaaatcaatggtgataaaggatttgaaccctccacgatt
agcattttgtacactgcatatctcgcgttatcagtgctgattcagttgccgatgactcga
tttttgaattcgttccggcgtaccagagtgctgataatgtctgcgggatgttgggcgatc
gcatttactctcgtgtgggtcacaggtgctttccattttgcgtgggcagttgccgtattt
ggcgtattggcggttgcgttggtcacgtatttgccgtcagcgtcagcgtttgttgtggat
ttagcacccgaatcgttgcgtggggtttatttaggcattaattcgcagtgctgggcattg
ggatattttattggaccgcccttaggcggttgggcattggatcaatctagggcgatcgcg
tctggatattggctgtttttagttgcaaccgttgcgatcgcggttctgattttacgagtc
ttggataaaatggtcagtcagaccccttctcatcgcctgtaa

DBGET integrated database retrieval system