KEGG   Leptolyngbya boryana: LBWT_X1350Help
Entry
LBWT_X1350        CDS       T04848                                 

Definition
(GenBank) Uncharacterized glutathione S-transferase-like protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
lbo  Leptolyngbya boryana
Pathway
lbo00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:lbo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LBWT_X1350
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lbo02000]
    LBWT_X1350
Enzymes [BR:lbo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LBWT_X1350
Transporters [BR:lbo02000]
 Other Transporters
  Pores ion channels [TC:1]
   LBWT_X1350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: BAS60063
LinkDB All DBs
Position
pLBX:128351..128992
Genome map
AA seq 213 aa AA seqDB search
MLKFYFAPLSINARRVWIALLEKQIPFEPILLNLDGDQCSAEFTKINPLQRVPVVIDDEL
ILVESLAILDYLEAQYPATALLPHDVNAIAIVRMICMICLTDLQPATIPLTKQLVGLPVE
AATVQTAQQRIIQILQFFEGLDDLTGNTFTLADIVAGTLVSSVPMFGISMASFPKLTAWL
ERLSARESFQQTAPSSDQIQAALPNLKKILETR
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaattctactttgctccgctctccatcaacgctcgacgggtttggattgcttta
ctggagaaacagattccctttgagccaattctgctcaacttggatggcgatcaatgctcc
gcagagtttacaaagattaatcctctacaaagagttccagttgtaattgatgatgaattg
atactggtagagtcgctagccattctagattatttggaagcgcaatatccagcgaccgcg
cttctgcctcatgatgttaatgcgatcgcaattgtccgtatgatttgcatgatttgtctc
accgatttacagcccgccacgatccccctgactaaacagcttgttggattgcctgttgag
gcggcaacagtgcaaacggcgcagcaacgcatcatccagattctgcaattctttgaaggt
ctagatgacttgacgggcaacacttttaccctggctgatattgtggcaggaactctggtg
agttcagttccgatgtttggcatttcgatggcatccttcccaaaactcaccgcatggctg
gagcgattatctgcacgcgagagttttcaacaaaccgccccctcatccgaccagatccag
gcagcattaccgaacctcaaaaagattttggaaacccgatag

DBGET integrated database retrieval system