KEGG   Lonsdalea britannica: CKQ53_06005Help
Entry
CKQ53_06005       CDS       T05623                                 

Definition
(GenBank) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
lbq  Lonsdalea britannica
Pathway
lbq00220  Arginine biosynthesis
lbq01100  Metabolic pathways
lbq01110  Biosynthesis of secondary metabolites
lbq01130  Biosynthesis of antibiotics
lbq01210  2-Oxocarboxylic acid metabolism
lbq01230  Biosynthesis of amino acids
Module
lbq_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:lbq00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    CKQ53_06005
Enzymes [BR:lbq01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     CKQ53_06005
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M42 DUF3088
Motif
Other DBs
NCBI-ProteinID: AXW86591
LinkDB All DBs
Position
complement(1290076..1291227)
Genome map
AA seq 383 aa AA seqDB search
MKMNLPPFIELYRALIATPSISATDSDLDQSNETLINLLAGWFTDLGFHVEVQPVPGTRH
KFNMLARRGEGSGGLLLAGHTDTVPFDDGRWTRDPFTLTEHDNRLYGLGTADMKGFFAFI
LDTLRDIDPATLSKPLYILATADEETTMAGAKFFSESTRIRPDCAIIGEPTSLQPVRAHK
GHMSKAIRIQGQSGHSSDPTRGVNAIELMHESITHLMTLRNTLQERYHNAAFHIPYPTMN
FGHIHGGDAANRICGCCELHMDIRPLPGMALNDFNGLLTEALEPVSSRWPGRLTINELHP
PIPGYECLADSPLAQVVEKLLGQPTEVVNYCTEAPFIQQLCPTLVLGPGSINQAHQPDEY
IDTSFIKPTRTLIAQLIHRFCQH
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatgaatttacccccttttattgagctgtaccgggcattaatcgctacgccatcc
attagcgccaccgatagcgacctggaccaaagtaatgaaaccttaatcaacctgttggca
ggctggtttaccgatctgggctttcatgtcgaagtccaacccgttcccggaacgcgtcat
aaattcaacatgctggcgcgccggggtgaaggcagcggcgggctgctgctggcgggccac
accgataccgtaccgtttgacgacgggcgctggacgcgtgatcccttcaccctgaccgaa
cacgataatcggctttatggcctgggcaccgccgacatgaaagggttcttcgctttcatt
ctggatacgctgcgcgatatcgaccctgctacgctctccaaacccctttatattctagcg
acggcagacgaggagaccacgatggcgggcgccaaatttttctccgagtccacgcgcatc
agaccggattgcgccatcatcggcgagcccacttcgctacagccggtgcgcgcgcacaaa
ggccacatgtccaaagcaatccgcattcagggccagtcaggccactccagtgacccgacg
cgcggggtcaatgccatcgaactgatgcacgagtccatcacacacctgatgacattgcgt
aataccctgcaggagcgctatcacaacgccgcgttccatatcccctacccgacgatgaac
ttcgggcatatacacggcggcgacgcggccaaccgtatctgcggctgctgcgaactgcat
atggatatccgcccgctgccgggcatggcgttgaacgatttcaacgggctgctgaccgag
gcgctcgagccggtcagttcccgctggccggggcgtctgaccatcaacgagctgcatccg
cctattcccggctatgagtgcctcgccgacagtcctttggcgcaggtggtggaaaagttg
ctggggcaaccgacggaagtcgtgaattactgtaccgaagcgccgtttatccagcagctc
tgcccgacgctggtgctcggccccggctccatcaatcaggcgcatcagccggatgaatat
atcgacacgtcgttcatcaagccgacccgcacgctgatcgcacagctgattcatcgtttc
tgccagcattga

DBGET integrated database retrieval system