KEGG   Lonsdalea britannica: CKQ53_07405Help
Entry
CKQ53_07405       CDS       T05623                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lbq  Lonsdalea britannica
Brite
KEGG Orthology (KO) [BR:lbq00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CKQ53_07405
Enzymes [BR:lbq01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CKQ53_07405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA Glutaredoxin FAD_binding_2 FAD_oxidored HI0933_like DAO NAD_binding_8 Thi4 FAD_binding_3 K_oxygenase NAD_binding_7 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AXW86831
UniProt: A0A1X3RPN7
LinkDB All DBs
Position
1587286..1588851
Genome map
AA seq 521 aa AA seqDB search
MLDNTMKVQLKAYLEKLTKPVELVATLDDSAKSSEVRELLTEIAGLSAQVSFTENNDLPV
RKPSFLITNPGSQSGPRFAGVPMGHEFTSLVLALLQVGGHPSKESQELLDQIRGLDGEFH
FETYYSLSCHNCPDVVQALNLMSVLNPNITHSAIDGGVFQDEIESRNVMGVPTVFLNGEH
FSQGRMTLSEIVNKIDTGASAKQVEQLNQRSVYDVLIIGSGPAGAASAVYSARKGIRTGL
MGERFGGQILDTVDIENYISVPKTEGAKLATALKSHVDDYDVDVIDAQTATALIPGAEPG
MPHQIETASGAVLKSRTIIISTGARWRNMNVPGEDQYRTRGVTYCPHCDGPLFKGKHVAV
IGGGNSGVEAAIDLAGVVKHVTLLEFAPELKADSVLQDKVRSLPNVDIIVNAQTTEVKGD
GQKVTGLSYKDRVSETEHELALEGIFVQIGLLPNTQWLEGTVARNRIGEIEIDAKCETSV
KGVFAAGDCTTVPYKQIIIATGEGAKASLSAFDYLIRTQSA
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacaatacaatgaaagtccagttgaaagcctacctggaaaaattaaccaaacct
gttgagttagtcgcgacgctggatgactcagcaaaatcttctgaagtcagagagttgctg
actgagatcgccggattatccgcacaggtcagtttcaccgaaaacaacgacctgccagtg
cgtaaaccctcttttcttattaccaatccgggttctcagagcggtccgcgtttcgccggc
gtaccgatgggacacgaatttacttccttggtgctggccttgctacaggtgggcgggcac
ccgtctaaagaatcccaggaattactggaccagattcgcggtctggatggcgagttccat
ttcgaaacttactactcgctgtcttgccacaactgccccgatgtcgttcaggcactgaac
ctgatgtcagtgctgaacccgaatatcactcatagcgcgatcgatggcggcgtattccag
gacgaaatcgagagccgtaacgtcatgggcgttccgaccgtgttcctgaacggcgaacac
ttcagccaaggtcgtatgaccctgagcgaaatcgtcaacaagatcgataccggcgccagc
gctaagcaggttgaacagctgaaccagcgttcggtctacgacgtcctgatcatcggcagc
ggccctgccggagcggcgtctgccgtctactctgcgcgtaaagggatccgcaccggtctg
atgggcgaacgtttcggcggccagatcctggataccgtagacattgaaaactacatttcc
gtgccgaaaacagaaggcgcaaaactggcgaccgcgctgaagagccacgtcgatgactac
gatgtcgatgtgatcgacgcgcagaccgcgacggcgctgatccccggtgccgagcccggc
atgccgcatcagattgaaactgcctccggcgcggtactgaagtctcgcaccatcatcatc
tctaccggcgctcgctggagaaatatgaatgtgccgggcgaagatcagtatcgcacccgt
ggtgtgacctactgcccgcactgtgacggcccgctgtttaaaggcaagcacgtggcggtc
atcggcggcggtaactctggcgtcgaagcggccatcgacctggctggcgtggtgaaacat
gtgacgctgttggaattcgcgcctgaactgaaagcagactccgtgctgcaggataaagtc
cgtagcctgccgaacgttgatatcattgttaacgcgcagacgacggaagtgaaaggcgac
ggccagaaagtgaccggactgtcgtataaggatcgcgttagcgaaactgaacacgagctg
gctctggaagggatcttcgttcagatcggtctgctgccgaacacccaatggctggaaggg
acggtggcgagaaaccgcatcggcgaaatcgagatcgacgcgaaatgcgaaaccagcgtt
aaaggcgtcttcgcggcgggcgactgcaccaccgtgccgtacaagcaaatcatcattgcc
accggcgaaggggcgaaagcctcgctgagcgcgtttgattacctgatcagaacgcagtcg
gcataa

DBGET integrated database retrieval system